Протеин виды: какой тип протеина лучше выбрать для похудения и набора массы

Содержание

какой тип протеина лучше выбрать для похудения и набора массы

После расщепления на аминокислоты протеин отправляется вместе с кровотоком в различные участки тела, где включается в формирование новых клеток и обменные процессы, строит мышечную ткань, обеспечивает энергетическую подпитку, поддерживает положительный азотистый баланс.

Белковый порошок – не стероиды и не «химия», а высушенный белок из натуральных источников. Поставляя заменимые и незаменимые аминокислоты, витамины, жиры и углеводы, протеиновый коктейль решает множество задач. Каких– зависит от вида продукта.

протеин: функции и роль в организме 

Биологические функции протеина (белка) очень разнообразны:

  • Регуляторная. Белки-ферменты, белки-активаторы поддерживают и катализируют биохимические реакции, задействуются в обмене веществ.

  • Структурная. Отдельные белки образуют цитоскелет – механический каркас клеток, отвечающий за их форму.

  • Сигнальная. Белки способны служить мостом, соединяющим клетки, ткани, органы и передающим сигналы между ними.

  • Моторная. Взаимодействие белковых молекул отвечает за произвольные и непроизвольные движения.

  • Защитная. Иммуноглобулины противостоят вирусам и бактериям; определенные белковые молекулы – связывают токсины и ускоряют их выведение. На уровне механической защиты коллаген отвечает за механическую устойчивость и эластичность кожи, хрящей, сухожилий, связок, кератин (тоже белок!) – за прочность волос и ногтей.

  • Транспортная. Самый известный белковый протеин-перевозчик – это гемоглобин, который доставляет кислород от легких в клетки и переносит углекислый газ в обратном направлении. Также есть мембранные белки, функция которых – транспортировка других молекул сквозь клеточную мембрану.

Построение новых мышц, энергоснабжение, поставка питательных веществ – это также возложено на белковый протеин. С учетом многообразия ролей и эффектов, возможно применение протеина (спортивного питания) в самых различных целях, от форсирования роста мышечной массы до поддержания хорошей физической формы, сушки и похудения.

в каких продуктах содержится протеин

Основные пищевые источники белков – продукты животного происхождения:

  • Все виды мяса.

  • Птица.

  • Яйца.

  • Молоко, творог и другие молокопродукты.

  • Рыба и морепродукты.

Поставщики белка растительного происхождения – орехи, семечки, злаки, бобовые.

Растительный протеин усваивается медленнее и хуже, чем животный, а его биологическая ценность ниже.
Современные ритмы не всегда позволяют придерживаться сбалансированного питания и получать положенную норму белков с пищей. В таких случаях целесообразно употреблять спортивные протеины. Белковые напитки усваиваются быстрее мяса, а выпить коктейль вкуснее и проще, чем съесть отварную грудку. К тому же благодаря огромному выбору вкусов и видов спортпит на основе протеина внесет здоровое разнообразие в меню.

виды протеина в спортивном питании и их назначение

Бодибилдинговые добавки выпускают в десятках разновидностей, каждая – со своим компонентным составом и, соответственно, действием. Свойства зависят от происхождения и способа производства. Для интенсивного массонабора рекомендуют сывороточный протеин, для защиты от ночного разрушения и кортизола – казеиновый.

ВИДЫ ПРОТЕИНА В СПОРТИВНОМ ПИТАНИИ И ИХ НАЗНАЧЕНИЕ .jpg

Рассмотрим вкратце основные виды и формы.

Сывороточный протеин (Whey Protein)

Самый распространенный вид белкового спортпита. Производится из молочной сыворотки – жидкости, оставшейся после створаживания и процеживания молока при изготовлении творога, казеина, твердых сыров.

Сыворотка содержит альбумины, витамины, минералы и жиры. У нее сбалансированный аминокислотный профиль, а потому протеин на основе сыворотки поставляет все необходимые аминокислоты, включая ценные BCAA.

Сывороточный протеин представлен концентратом, изолятом и гидролизатом.

  1. Концентрат – сывороточный протеин минимальной очистки. Содержит следы лактозы и жиров. Стоит дешевле других форм, хотя не уступает им по качеству и популярности. Отлично подходит для начинающих атлетов.

  2. Изолят – фактически концентрат, прошедший дополнительную очистку. Стоит дороже, но усваивается быстрее, почти не содержит углеводов и обладает большей питательной ценностью. За счет малого содержания сахаров может применяться во время низкоуглеводной диеты.

  3. Гидролизат – сывороточный протеин, искусственно «разобранный» на пептидные цепи, фрагменты из нескольких аминокислот. Содержит только белок, причем в самой быстроусвояемой форме. Диетологи уверяют, что скорость всасывания не всегда оправдывает высокую стоимость гидролизованного протеина.

Все формы протеина из сыворотки всасываются быстро (за 2-3 ч), поэтому актуальны и до, и после нагрузок.

Казеиновый протеин (Casein Protein)

Белок медленного усвоения («медленный протеин») производится натуральным способом – ферментным створаживанием молока. После попадания в желудок образует мицеллы – сгустки, которые будут расщепляться до аминокислот в течение 6-8 ч. Казеиновый протеин не вызывает резкого скачка сахара, дает длительную аминокислотную подпитку, обеспечивает мощную антикатаболическую защиту. Обычно казеин принимают на ночь, чтобы предотвратить распад мышц до следующего приема пищи.

Доказано, что во время ночного сна надпочечники выбрасывают кортизол – гормон стресса. Прием казеинового коктейля перед сном или долгим перерывом в еде оберегает мышечную ткань от разрушительного действия кортизола.

Казеин надолго утоляет голод и может использоваться для снижения жировой массы. Но также его принимают для наращивания мускулатуры. Еще одно достоинство казеинового протеина – его могут пить атлеты с аллергией на сывороточный и яичный белок.

Молочный протеин (Milk Protein)

Активный белковый комплекс, смесь казеина и сыворотки в пропорции 4:1 – 80% казеинового протеина, 20% сывороточного протеина. В молочном протеине сочетаются преимущества обоих продуктов: он отлично насыщает, предотвращает катаболическое разрушение мышц, подходит для приема между едой.

Комплексный протеин

А это – многокомпонентная протеиновая добавка, обогащенная креатином, витаминами, минералами и другими ингредиентами прицельного действия.

Мультипротеин состоит из белков разного происхождения (животные + растительные) или разной скорости всасывания (казеин + концентрат, соя + яичный белок). Подобная комбинация создана для длительного анаболизма, предотвращения катаболизма и долгосрочного снабжения мышц аминокислотами. Комплексный продукт усваивается так же быстро, как сывороточный протеин, но работает в течение 5-7 ч. Первым начинает действовать быстрый протеин в составе, что дает экспресс-выброс аминокислот, затем подключается медленный белок (казеиновый или растительный).

Комбинированное действие мультикомпонентных коктейлей предотвращает катаболизм, повышает анаболизм, способствует массонабору и снижению веса. Сочетание нескольких видов белка растит и подпитывает мышечную ткань и оптимально подходит и для начинающих, и для легкоатлетов, тренировки у которых длятся дольше часа.

влияние протеина на организм мужчины и женщины

Все протеиновые смеси поставляют строительный материал для мышечных белков. Если говорить о белке в контексте спортивного питания, то именно такие добавки полезны для роста мышц и снижения веса.

Особенно хороши протеины сразу после занятий. Белковый коктейль, носитель аминокислотного материала, помогает запустить восстановительные процессы, предотвратить развитие катаболического состояния. Если после нагрузки не принять протеин, последующая регенерация будет направлена не на построение новых мышечных волокон, а на ремонт мышц, поврежденных в ходе тренировки или пострадавших от катаболизма.

Польза приема протеина

  • Снабжает энергией, необходимой для тренировки и после нее.

  • Поставляет незаменимые и заменимые аминокислоты, что активирует выработку инсулина и соматотропина – гормонов, ответственных за прирост мышц и прочность костей.

  • Активирует метаболизм, что приводит к гипертрофии (росту) мышц. Даже метаболиты протеина – аминокислоты – участвуют в анаболизме.

  • Подавляет разрушительные процессы. Снижая выброс кортизола, катехоламинов и других катаболических гормонов, аминокислоты из протеина защищают мышечную ткань.

  • Укрепляет иммунитет. Альфа- и бета-глобулины, иммуноглобулины, ферменты и витамины в составе протеина вносят вклад в работу иммунной системы.

  • Снижают риск сердечных заболеваний. У тех, кто принимает сывороточный протеин, на 8% реже диагностируют болезни сердца.

Вред и побочные эффекты от приема протеина

Как и любой продукт питания, белковые смеси могут спровоцировать аллергическую реакцию. Обычно речь идет об АБКМ (аллергии на белки коровьего молока), непереносимости лактозы (из-за нехватки фермента лактазы, расщепляющего молочный белок) и другие компоненты в составе. Предотвратить нежелательные эффекты несложно, если выбрать протеин без лактозы или добавку, дополненную лактазой.

Другие побочные явления:

  • Метеоризм, дискомфорт в желудке, диарея, запоры – проходят после корректировки диеты.

  • Нагрузка на печень и почки.

  • Накопление молочной кислоты, что грозит мочекаменной болезнью.

Установлено, что все перечисленные неприятности чаще всего связаны с превышением дозировки и неправильным выбором товара. Поэтому протеин для спорта нужно выбирать в линейках надежных брендов и покупать только лучшее.

Какой протеиновый коктейль лучший?

Чтобы сориентироваться, какой протеин лучше для сушки или наращивания мускул, нужно оценивать все параметры: состав, вкус, назначение, соотношение цены и качества.

КАКОЙ ПРОТЕИНОВЫЙ КОКТЕЙЛЬ ЛУЧШИЙ? .jpg

Рейтинг протеинов 2020

Лучший сывороточный протеин (быстрый)

Чем быстрее усваивается добавка, тем выше анаболический эффект. Такие средства подходят для массонабора, работы на рельеф, но могут использоваться во время ограничительной диеты на похудение – для сохранения имеющихся мышечных объемов.

Приведем несколько названий для трех видов сывороточных протеинов. Начнем с самых распространенных – концентратов сыворотки.

ЛУЧШИЙ СЫВОРОТОЧНЫЙ ПРОТЕИН (БЫСТРЫЙ) .jpg

Лучшие изоляты сывороточного белка

  1. ISO-100 от Dymatize – первое место за сравнительно низкую стоимость, минимум углеводов, натуральные вкусы и 100% изолята протеина.

  2. Iso Sensation от UN – аналогичен предыдущему.

  3. Supreme Whey Protein компании Binasport – на 86% состоит из протеина.

Если надо купить протеин для роста и выбрать изолят, следует внимательно читать этикетку. Формулы некоторых марок включают заменимые аминокислоты, но все они указаны как пищевой протеин.

Лучшие гидролизаты сывороточного протеина

  1. Platinum Hydro Whey от ON – 8,8 г BCAA из 15,5 г эссенциальных аминокислот и всего 3 г углеводов на порцию!

  2. Syntha-6 от BSN – хорошо изученная добавка с отменным качеством по лояльной цене. Впрочем, некоторые относят продукт к многокомпонентным протеинам.

  3. Hydropure Nutrabolics – протеин уже разделен до аминокислот и пептидов, действует быстро.

Из-за специфики изготовления большинство гидролизованных сывороточных протеинов практически идентично аминокислотным комплексам.

Лучший казеиновый протеин (долгий)

  1. 100% Casein Protein (ON) – предсказуемое качество, хорошая биодоступность.

  2. Lipotropic Protein (LG Sciences) – содержит БЦАА для активации анаболизма, полифенолы для жиросжигания и

  3. 100% Casein (Dymatize) – добавка с отличным вкусом.

Казеиновый протеин – это, в первую очередь, блокировка катаболизма. Когда сывороточный протеин уже заканчивает свое действие, казеиновый продолжает поставлять аминокислоты, поддерживая мышечный рост.

Лучший комплексный (многокомпонентный) протеин

  1. Protein 80 Plus от Weider – четыре вида белка (казеин, яичный альбумин, концентрат и лучший изолят сывороточного протеина для мгновенного насыщения). Хороший выбор по хорошей цене.

  2. Matrix от Syntrax – смесь трех протеинов высшего качества.

  3. Elite Gourmet Protein от Dymatize – едва ли не самый дешевый мультипротеин на рынке.

  4. Probolic-S от MHP – поставщик всех необходимых аминокислот. На последнем месте в рейтинге из-за высокой цены и соевого белка в составе

Упомянутый выше комплексный протеин Syntha-6 от BSN по соотношению белков и углеводам мог бы считаться гейнером, полезным для роста мышц и прибавки массы. Но производитель настаивает, что простых сахаров в составе немного, остальные углеводы представлены веществами, которые улучшают усвояемость добавки, но не перевариваются организмом человека. Жиры в Syntha-6 – триглицериды, которые ускоряют жиросжигание.

Рейтинг по назначению

Строго говоря, протеины нельзя разделить на способствующие набору мышечной массы и добавки для похудения. Но в целом можно найти белковые комплексы, больше других соответствующие снижению веса или приросту мышц.

Для прироста мышц

Самые полезные для набора массы – быстрые протеины: яичный, сывороточный. Они быстро распадаются до аминокислот, насыщая ткани нутриентами. Вместе с ними идеально принимать медленные белки (казеин), чтобы поддержать растущие мышцы ночью.

Когда цель – увеличение мышечных объемов, стоит выбирать продукты с минимальным содержанием жиров. Для роста мышц и рельефности подойдут гидролизованные протеины и комплексы: BSN Syntha-6, Dymatize ISO-100.

Для быстрой прибавки качественной массы эктоморфам (худощавым людям с быстрым метаболизмом) нужны гейнеры – углеводно-белковые смеси.

Для похудения

Для уничтожения жировой прослойки важно создать дефицит калорий, причем за счет углеводов, но не жиров. Худеющим нужно получать 1 г жира и до 2 г белка на килограмм массы. Лучший протеин для похудения – тот, в котороммало липидов и углеводов, например, изолят сыворотки Syntrax Nectar. Кроме сывороточного, можно принимать казеиновый или соевый протеин, но в этом случае снижение веса пойдет более спокойным темпом.

Ряд исследований на влияние спортивных протеинов на похудение дал интересные результаты. 1. Больше жира потеряли те, кто принимал белок, а не просто сидел на диете, причем лучшие показатели дали казеиновые добавки (в сравнении с сывороточными). 2. Соевый белок дает худший результат по похудению, если сравнивать с сывороткой, но лучший в сравнении с чистой диетой без приема спортпита. Сывороточный протеин сжигает больше жира, чем эквивалентное количество мяса.

Протеин при непереносимости лактозы

Специализированные продукты созданы для тех, кто не может употреблять классические протеиновые добавки. Прежде всего, это спортпит на основе белка куриных яиц, в которых присутствуют все важные аминокислоты, например, Healthy ‘N Fit 100% Egg Protein.

Для людей с гиполактазией лучше взять следующие протеины:

  • Изолят All Max IsoNatural без лактозы, глютена, сои, добавленных сахаров, зато с пребиотиками и ферментом лактазой для лучшей усвояемости.

  • Гидролизат Platinum Hydrowhey (ON) – ультрафильтрованный сывороточный протеин молниеносного переваривания и действия.

  • Advanced Soy Protein (UN) – производится из сои, обработанной водой, а не алкоголем, содержит изофлавоны, ускоряющие усвоение продукта.

Людям, не употребляющим животные белки, производители предлагают добавки на основе изолятов гороха, бурого риса, артишока, семян Инчи, конопли, артишока. Вегетарианский спортпит обогащают энзимами, L-глютамином, BCAA.

Рейтинг производителей протеина

В начале 2015 года проводилась экспертиза, на которую отправились марки протеина из России, Великобритании, Германии, США. Участники:

  1. ON Gold standard 100% Whey.

  2. Weider Gold Whey.

  3. Power System Triple Whey.

  4. Dymatize Elite 100% Whey Protein.

  5. Beowulf Whey PRO.

  6. VPLabLab PRO 5.

  7. BSN IsoBurn.

  8. PureProtein Whey Protein Base Line.

Все добавки были зарегистрированы как спортивное питание – кроме отечественного протеина PureProtein, которая проходила как белковый напиток.

По итогам в черном списке Росконтроля оказались:

  • PureProtein и Beowulf – отечественный протеин вылетел в аутсайдеры за несоответствие реальной массовой доли белка указанной на этикетке;

  • Фирма Dymatize – за обнаруженный в составе крахмал.

Самые качественные протеины, по итогам тестирования:

  1. Британский VP PRO 5.

  2. Немецкий Weider Gold Whey.

  3. Американский ON Gold Standart 100% Whey.

У товаров, возглавивших ТОП лучших протеинов, не выявлено критических недостатков и самая высокая концентрация эссенциальных аминокислот, они безопасны и эффективны. Интересно, что в американском Gold Standart белка нашли больше, чем значится на упаковке: 78,7%, а не 77,4%.

Применение протеина при наборе массы и похудении

Тактика для набора мышечной массы или похудения выстраивается на приеме протеина в тренировочное и околотренировочное время. Данная стратегия облегчает восстановление и формирование мышечной ткани, обеспечивает прибавку силы и выносливости, активирует жиросжигание и прорисовку рельефа.

Показания к применению протеина

  • Дополнительное поступление протеина до и после нагрузки.

  • Прирост мускулатуры.

  • Снижение процента жира.

  • Ускорение восстановительных процессов.

  • Противопоказания

Противопоказания

  • АБКМ.

  • Гиполактазия.

  • Аллергия на компоненты.

  • Серьезные нарушения функций печени, почек.

Нормы приема

В рамках обычного тренировочного процесса достаточно 1,2-2,2 г белка на каждый килограмм массы тела.

Протеиновые коктейли принимают утром, за 60-90 мин до тренировки, через 60 мин после занятий, а также в длинные перерывы между едой. Казеин может дополнить или заменить вечерний прием пищи.

Ориентироваться нужно на порции в 30 г (по другим источникам – до 40-50 г).

Для приготовления коктейля порошок растворяют в любой жидкости по вкусу – воде, соке, маложирном молоке.

Разбавленный порошок надо употребить сразу. После приготовления коктейль хранится не более 3 ч.
НОРМЫ ПРИЕМА.jpg

Взаимодействие протеина с другими средствами

Спортсмены принимают как разные виды протеинов в разное время, так и белок в комбинации с гейнерами, аминокислотами, предтрениками.

Выбирать спортпит для набора мышечной массы и рассчитывать нагрузку лучше с персональным тренером. Профи объективно оценит параметры тела и перспективы в спорте, подскажет эффективную методику питания и тренинга.

Какой тип протеина выбрать?

Каждый продукт может быть полезен в бодибилдинге:

  • Быстрый протеин – идеальный по цене-качеству.

  • Казеин, мультипротеин – поддержка в ночное время.

  • Яичный белок, гидролизат – быстроусвояемый, но дороже сывороточного.

Список самых популярных добавок возглавляют американские и европейские марки, самые доступные – выпускаются в России и Азии. В числе наиболее эффективных и безопасных сывороточных протеинов преобладают товары признанных лидеров: Dymatize, Syntrax, Optimum Nutrition, BSN, Weider и др. Впрочем, российский протеин также достоин внимания!

Обращайтесь, консультанты магазина расскажут, как и какой выбрать протеин для набора мышц, какая добавка ускорит сушку, протеин какой фирмы купить для поддержания имеющейся формы.

Виды протеина, их различия и назначение в спорте

Основные виды протеина в спортивном питании

  • Соевый;
  • Сывороточный;
  • Казеиновый;
  • Яичный.

Соевый протеин считается самым дешевым – но и наименее эффективным. Он актуален для веганов, так как дает практически весь нужный набор аминокислот. Кроме того, он содержит фитоэстрогены – вещества, схожие с женскими гормонами, и большое их количество может быть вредно для мужского организма.

То же можно сказать и про другие растительные белки – например, гороховый или пшеничный. Но их аминокислотный состав менее сбалансирован, чем соевый, потому растительные виды протеина редко используют в спортивном питании.

Сывороточный Whey всасывается за час-два после приема, когда как Micellar Casein – за шесть-семь. От этого и происходит различие в методе их приема – Whey пьют после тренировки, тогда как Micellar Casein – вечером, перед сном.

Также существует так называемый комбинированный протеин – это смесь сывороточного и казеинового, иногда еще и яичного или соевого. Его еще называют мультипротеин или универсальный. И действительно: такую смесь можно пить как после тренировки, так и перед сном, а также в нетренировочные дни, чтобы восполнить общий недостаток белка в рационе.

Отвечая на вопрос, какие есть виды протеина, нельзя не упомянуть мясной белок. В спортивном питании чаще встречается говяжий. Считается, что его аминокислотный состав – идеален, кроме того, мясной протеин по умолчанию обогащен креатином. Но вот мнение, эффективнее ли он, чем сывороточный, пока не доказано – исследования на сегодняшний день сходятся на том, что особой разницы нет. А вот то, что его цена выше, чем даже яичный – гарантированно. Кроме того, протеин, полученный из красного мяса, может вызывать аллергию и по некоторым отзывам обладает малоприятным привкусом

Самый популярный спортпит: сывороточный протеин

Считается, что Whey – лучший вид протеина, чтобы сразу после тренировки восполнить уровень аминокислот в организме, и таким образом упростить восстановление мышц. Если при этом соблюдается профицит калорий в ежедневном рационе, то сывороточный протеин будет стимулировать рост мышечной ткани. Так Whey — наиболее подходящий вид протеина для сушки, похудения, но применяется и для массонабора.

Есть несколько видов сывороточного протеина. Их различия в первую очередь заключаются в степени очистки:

  • Концентрат – самая популярная и распространенная форма, он сохраняет большинство полезных свойств белка.
  • Изолят отличается быстрой усвояемостью и повышенным содержанием аминокислот с разветвленной цепью (незаменимых BCAA).
  • Гидролизат – самая дорогая форма, с максимальной скоростью усвоения и более высокой способностью стимулировать секрецию инсулина.

Пока не существует достаточно достоверных данных о том, какая форма лучше, но минус изолята и гидролизата очевиден – цена данных видов сывороточного белка способна нанести удар вашему кошельку. Изолят и гидролизат считаются более подходящими для аллергиков. Также важно помнить при выборе белка, что гидролизат обладает горьковатым привкусом.

«Эталон белка» — яичный протеин

Аминокислотный профиль яичного белка считается самым подходящим для человека. Он включает в себя полноценных набор: как незаменимые аминокислоты (лейцин, валин, а в особенности – изолейцин), так и заменимые.

Также отмечается хорошая усвояемость этих аминокислот именно из яичного протеина. А отсутствие жиров с углеводами и высокая питательная ценность позволяют считать яичный протеин практически идеальным как для набора массы, так и для сушки. В том числе, в яичном протеине совсем нет лактозы – молочного сахара, непереносимость которой может создавать серьезные сложности в употреблении сывороточного протеина.

Из минусов яичного протеина можно назвать разве что сложность и, как следствие, дороговизну его производства. Сывороточный и казеиновый белки производят из сырья, остающегося от сыроделия, а для изготовления яичного протеинового коктейля необходимо отдельное производство. Соответственно – цена яичного протеина немного выше, чем сывороточного, хотя эта разница соизмерима с его преимуществами.

Медленный белок: казеин

Казеиновый белок, получаемый при створаживании молока, усваивается гораздо дольше других видов. Это значит, что если вы съели порцию казеина, вам еще долго не будет хотеться есть. Выпитая перед сном порция казеинового протеина не дает организму почувствовать истощение и погнать вас в ночи к холодильнику. Это особенно актуально при похудении и склонности к ночному голоду. При это казеин способствует восстановлению мышц после тренировки до самого утра, а потому считается подходящим видом протеина для набора мышечной массы – ведь многие восстановительные и «строительные» процессы в мускулатуре происходят именно ночью.

Кроме того, что казеин сам по себе усваивается медленно, он замедляет и усвоение других видов белка. Также замечено, что он замедляет катаболические процессы в мышцах, снижая пагубное воздействие гормона стресса – кортизола.

В чистом виде казеиновый протеин обладает неприятным привкусом и не очень хорошо размешивается без блендера. Современная форма казеина – мицеллярная, позволяет избавиться от этих недостатков.

Рекомендации специалистов Prime Kraft

Если вы стремитесь набрать мышечную массу, мы рекомендуем в первую очередь сывороточный протеин WHEY – одна порция после тренировки, разведенная в воде или нежирном молоке.

Если вы худеете или сушитесь – то ваш выбор MICELLAR CASEIN на ночь. Его лучше разводить водой, чтобы не нарушать калорийность коктейля – ведь и в молоке и в соке все равно есть «лишние» жиры и углеводы. Можно заменить казеином часть ужина или даже весь.

Комплексный MULTI PROTEIN подходит для тех, кто озадачен в основном поддержанием формы и хочет восполнить недостаток белка в рационе. Так, порцию MULTI PROTEIN можно выпивать в качестве перекуса и полдника, как в тренировочные, так и в свободные дни.

Универсальным можно назвать EGG PROTEIN  — его скорость усвоения чуть меньше, чем у сывороточного, но в то же время достаточно быстрая, чтобы восстановить мышцы после тренировки.

По промокоду BLOG в официальном интернет-магазине primekraft.ru скидка на весь ассортимент 10%! Доставка по всей России.

Виды протеина, его функции и применение

Какую роль играет белок в организме человека.
Почему он так важен для спортсменов.
Каких видов бывает протеин, чем они отличаются.

Белок — главный участник жизненно важных процессов, без которых говорить о крепком здоровье бессмысленно. Белок, протеин, полипептиды — все это названия одного вещества, которое формируется из цепи аминокислот посредством ковалентной связи. Именно он является основой живых тканей организма, главным строительным материалом. Его поступление обеспечивает положительный азотистый баланс и ускоряет рост мускулатуры.
В узком смысле протеин — спортивное питание, которое применяется представителями силовых и других видов спорта. В основе таких добавок лежит концентрированный белок.

Какие функции он выполняет протеин?
Для чего он нужен организму протеин?
Каких видов бывает протеин и нюансы каждого из них?

Ценность протеина в организме сложно переоценить. Он выполняет следующие функции:

Строительную. Белок — составляющий элемент каждой клетки нашего тела, структурная единица живых тканей, главный «стройматериал» для мышечных клеток. Его стабильное поступление гарантирует нормальную работу организма и его систем, рост мышц, ногтей и волос.

Гормональную. Не секрет, что главные в физиологических процессах — гормоны. Последние также представляют собой полипептиды. Чтобы нормализовать уровень гормонов, нужно обеспечить поступление достаточного объема белка, который нужен для выполнения ключевых задач.

Ферментативную. Протеин — главный катализатор химических реакций, которые протекают в клетках нашего тела. Его задачи — нормализация и регуляция обменных процессов в организме. Его дефицит приводит к низкой степени усвояемости витаминов и кальция. Не секрет, что полезные компоненты усваиваются только при наличии достаточного объема ферментов (белковых структур). Если человек принимает в пищу фрукты и салаты, но при этом объем белка ниже нормы, то польза от упомянутых продуктов близка к нулю.

Защитную. Протеин нужен для нейтрализации вредных и опасных токсических веществ. Научно доказано, что его нехватка приводит к ослаблению иммунной системы, снижению стойкости организма к инфекционным заболеваниям, уменьшению объема выработки антител.

Транспортную. Белок — главный «транспорт» в кровеносной системе человека. Он нужен для переноса липидов, витаминов, углеводов и лекарственных компонентов в отдаленные участки тела. При его нехватке жидкость не удерживается в структуре клеток, а переходит в форму межклеточной субстанции.

Энергетическую. Многие уверены, что единственный источник энергии — углеводы. Но это не так. Полипептиды при определенных условиях способны выполнять такую же функцию. Минус только в том, что такой процесс выработки энергии достаточно трудоемкий.

Информационную. Белок — носитель информации. Если организм недополучает какую-либо из аминокислот, то возможны мутации генов. Итог — появление серьезных заболеваний и даже онкологии. Чтобы избежать таких проблем, человеку нужен полный комплекс аминокислот, которые поступают из пищи или добавок.

Если рассматривать пользу протеина с позиции бодибилдинга, то он необходим для решения следующих задач:

Ускорение роста мышечной массы. Выше уже упоминалось, что полипептиды — главные строители мускулатуры. При нехватке белка рассчитывать на формирование фигуры мечты не приходится.
Похудение. Протеин — надежный помощник в вопросе подавления чувства голода. Наличие достаточного объема белка — толчок для сжигания лишних жировых отложений во время тренировки. Кроме того, от объема мышц зависит, насколько быстро будут расщепляться жиры даже в состоянии покоя.
Формирование рельефа. Эта опция непосредственным образом связана с двумя предыдущими. Ускорение прироста мышц и помощь в похудении гарантирует ожидаемую рельефность тела.
Укрепление защитных функций организма. Человеческое тело обновляется каждую секунду. В нем происходят миллионы разных процессов, которые невозможны без участия протеина.

Виды и особенности протеина

Яичный. Принято считать, что этот тип отличается наибольшим качеством и пользой для организма. По сути, это эталонный продукт, на который ориентируются другие виды полипептидов. Недостаток — высокая цена.
Сывороточный. Такой белок востребован спортсменами благодаря высокой скорости усвоения и качеству. Добавки, в основе которых лежит сывороточный протеин, покрывают потребности мышц в аминокислотах. Исследования доказали, что мышечные волокна получают питание уже через 40-60 минут после приема. Преимущества — цена, быстрая усвояемость, качество.
Казеин — медленный белок. Отличается тем, что дольше других усваивается в организме. Объясняется это сложной конструкцией, а также створаживанием под действием ферментов желудка. В среднем казеин переваривается в течение 5-7 часов, обеспечивая этот период мышцы полезными компонентами.
Соевый — имеет богатый аминокислотный состав. Его прием способствует нормализации уровня холестерина и покрытию текущего дефицита полипептидов. Такой продукт подходит для спортсменов, организм которых не справляется с лактозой или которые относят себя к категории вегетарианцев. Недостатки — низкий параметр биологической активности, наличие эстрогенов, которые плохо влияют на организм мужчины.
Растительный. Главный недостаток — плохая усвояемость, что обуславливает минимальную популярность добавки.
Комплексный — особый тип спортивного питания, представляющий собой смесь нескольких видов белка. Отличается тем, что поставляет в организм и медленный, и быстрый белок. Это гарантирует равномерное поступление аминокислот к мышечным клеткам в течение нескольких часов и максимальный результат от тренировочного процесса.

Кроме того, протеин можно классифицировать и по способу производства. Здесь выделяют следующие варианты:

Изолят — наиболее чистая форма. Такие белки добываются посредством ионного обмена или фильтрации. На выходе порошок содержит 95% чистого продукта. Жиров и лактозы минимум. Изолят хорош для приема после занятий и с утра. С его помощью удается быстрее справиться с лишним жиром и добиться рельефности.
Концентрат — первая форма белка, которая не отличается идеальной очисткой. На выходе получается субстанция, в которой 35-85% протеина. Недостаток такого состава — высокий уровень жиров и лактозы, что часто приводит к появлению газов и побочным эффектам с ЖКТ. Такой тип питания хорош в случае, когда денег на покупку более дорого порошка нет.
Гидролизат — продукт, который получается путем гидролиза. Преимущество заключается в том, что организм получает уже подготовленный к расщеплению белок, что гарантирует его самую быструю усвояемость.

В процессе организации рациона стоит учесть следующее

-Чтобы восполнить организм полипептидами и получить результат, стоит знать, в каких продуктах содержится белок и в каких из них он наиболее полезен. Главные его поставщики — продукты питания животного происхождения, среди которых рыба, птица, молоко, творог, мясо и яйца. Источники растительных белков — бобовые и злаки.
-Суточная дозировка протеина составляет 1,2-1,5 грамма на кило веса. При активных занятиях спортом дозировка возрастает до уровня 2-2,5 грамм. Ошибка новичков-спортсменов заключается в том, что они принимают спортивное питание, забывая о важности природных белков. Здесь соотношение должно быть следующим — 60-70% поступает из пищи, а остальное — из добавок. При этом в рационе должен быть растительный и животный белок в соотношении 1 к 4.
-Белки, которые были подвержены тепловой обработке, быстрее усваиваются. Это связано с ферментами человеческого тела, которые с обработанными веществами справляются быстрее. Но стоит помнить, что такая обработка приводит к разрушению ряда аминокислот и снижению биологической ценности.
-В спорте протеин способствует насыщению тела белковыми структурами, что ускоряет рост мускулатуры. Мышцы приобретают плотность, становятся толще, увеличивается масса тела.
-В процессе приема добавки в форме порошка не рекомендуется превышение дозировки. В противном случае она не усвоится и уйдет с мочой и стулом.
-При наборе массы посредством приема спортивного питания стоит учитывать не только тип добавки, но и правила ее употребления. Ключевую роль играет ритмичность питания. Если не удалось нормально перекусить в обычное время, то порция протеина способна заменить один из приемов пищи.
-Вместе с белком в организм должны поступать и другие компоненты, среди которых жиры, углеводы, витамины и минералы. Без них полноценное усвоение аминокислот невозможно

Виды протеина и их различия

Если стало понятно, что вы не добираете белок с обычной едой, что на физические нагрузки порой не хватает сил, а мышечный тонус уже не тот, стоит всерьез присмотреться к спортивным белковым добавкам – протеинам. А их для нас разработали уже несколько видов со множеством вкусов.

<<Начало статьи читайте здесь

Сразу хочу донести важную мысль: в протеиновых продуктах нет разделения на «мужские» и «женские», как нет молока или сыра, который подходит только мужчинам или только женщинам.
Протеины делятся на три основные группы: молочный ( сывороточный и казеин ), яичный, растительный. Их еще прекрасно миксуют, создавая универсальные смеси – многокомпонентные протеины. Определим их в отдельную группу.

МОЛОЧНЫЙ ПРОТЕИН:

При производстве сыра и творога остается побочный продукт в виде сыворотки. Раньше её просто сливали. Сейчас же все ценные и питательные вещества сыворотки идут на изготовление сывороточного протеина. А белки, которые остаются в твороге – на изготовление казеина. Главное отличие сывороточного протеина и казеина — в скорости усвоения:

  1. Сывороточный протеин способствует росту мышечной ткани, то есть является хорошим анаболиком. Он очень быстро дает мощную поддержку нужными аминокислотами нашим мышцам, поэтому как правило его принимают за 30-40 минут до тренировки или через 30-40 минут после тренировки. Также есть еще один вариант приема: утром, сразу как проснулись, в качестве «скорой помощи» нашим мышцам против разрушительного действия кортизола (гормона стресса, разрушающего мышечную ткань), который активен с 6 до 10 утра. Время работы сывороточного протеина – 1-2 часа.
    На рынке спортивного питания представлены три вида сывороточного протеина: концентрат, изолят и гидролизат. Их отличие всего лишь в степени очистки. Самым популярным видом является изолят благодаря более мягкому вкусу, к тому же он содержит минимум жиров и лактозы.
    Содержание в одной порции (30 грамм): белки – 22-24 гр, жиры – 2-2,2 гр, углеводы – 2,1-2,3 гр, Ккал – 110-120.

Протеин в бодибилдинге — SportWiki энциклопедия

Домашний протеиновый коктейль

Южаков Антон Протеин (белок). Всё, что нужно знать о белке. Нормы в сутки, скорость усвоения, скорость переваривания, лучшие источники белка, полноценный и неполноценный белок Южаков Антон Лучшие белковые продукты: Мясо, Рыба, Молочные продукты, Яйца, соя и орехи. Подробный разбор каждого продукта белковые продукты Белковый обмен в организме

Информация для новичков

Протеин — это спортивная добавка, которая сделана на основе белковых смесей. В пищеварительном тракте протеин расщепляется ферментами до аминокислот, которые всасываются в кровь и затем используются мышцами и другими тканями.

В более широком смысле протеин (белок, полипептиды) — это органические вещества, состоящие из соединённых в цепочку аминокислот ковалентной связью и образующие полипептид. Именно белки составляют основу мышечной ткани и являются ключевым диетическим компонентом. Рост мышц возможен только тогда, когда в организме создаётся положительный азотистый баланс. Кроме того, под протеином в бодибилдинге понимают вид спортивного питания, который состоит из концентрированного белка.

Функции белков организма очень разнообразны. Белки-ферменты обеспечивают протекание биохимических реакций и играют важную роль в обмене веществ. Некоторые белки выполняют структурную или механическую функцию, образуя цитоскелет, поддерживающий форму клеток. Также белки играют важную роль в сигнальных системах клеток, при иммунном ответе и в клеточном цикле. В бодибилдинге основное значение придаётся сократительной функции белков — все произвольные и непроизвольные движения производятся за счёт взаимодействия белковых молекул.

Почему Вам не хватает белка? Реальные показатели потребления белка. Автор: Борис Цацулин

Виды протеина и уловки прозводителей

Учитывая многообразие функций и биологических эффектов белка и его составляющих — аминокислот, в бодибилдинге белки используют в разных целях: для снижения жировой массы тела, для стимуляции роста мышц, а также с целью поддержания здоровой физической формы. Рассмотрим подробнее функции белков, актуальные для конкретной спортивной деятельности и все вопросы их применения.

Пищевые источники белка[править | править код]

Виды белка[править | править код]

Рейтинг различных видов протеина

Проверка на подлинность[править | править код]

Широко распространён простой способ проверки белка на подлинность путём залива его кипятком, иногда с последующим кипячением, вследствие чего наблюдается процесс денатурации с образованием характерных хлопьев и выпадением осадка. Для усиления реакции желательно добавить несколько капель уксуса, чтобы понизить pH раствора и нейтрализовать отрицательный заряд.[1]

Результаты исследования показаны в видеоролике, где можно наблюдать реакцию именно сывороточного белка.

Проверка на подлинность

Некоторые продукты не проходят проверку ввиду плохой очистки, тогда как нормальный сверхочищенный концентрат всегда должен выпадать в осадок. Некоторые производители дают другое объяснение. Для денатурации серьёзное значение имеет заряд белка. Если заряд молекул высокий, то белок устойчив к нагреванию (происходит взаимоотталкивание молекул), что мы и наблюдаем в некоторых случаях. Даже если строение белка и меняется от температуры, то в осадок не выпадает.

Известный пример: молоко можно кипятить и оно не сворачивается именно из-за сильного отрицательного заряда молочного альбумина, казеин в молоке находится в виде предшественника казеиногена и тоже хорошо растворим. При скисании молока кислоты нейтрализуют заряд белков, и молоко створаживается.

Дополнительные показатели качества:

  • Оформление этикетки по правилам таможенного союза
  • Указание аминокислотного профиля
  • Наличие свидетельств о государственной регистрации
  • Достоверность информации о содержании белка
Лабораторная проверка качества[править | править код]

Важно знать, что является источником белка, откуда производители его получали. В России производства сывороточного белка нет, просто нет таких заводов.[2] Это однозначно импортное сырьё, а оно может быть разного качества. Основной тест — аминокислотный скор.

Какой протеин выбрать[править | править код]

Оптимальные дозы протеина в сутки[править | править код]

Сколько белка усваивается за раз? 30г белка за один приём пищи. Автор: Борис Цацулин

Нередко заявляется, что потребность в протеине не превышает 2 грамм на килограмм массы тела в сутки. В исследование Jose Antonio[3], опубликованном в научном журнале JISSN в 2015 г было проведено сравнение между 2 группами участников:

  • Участники 1 группы получали 3,4 г/кг/сут и в среднем они увеличили массу на 2,5 кг, снизили жировую массу на 1,7 кг, процент жира снизился на 2,4%
  • Участники 2 группы получали 2,3 г/кг/сут. Они увеличили массу на 1,3 кг, снизили жировую на 2,2 кг, процент жира уменьшился на 0,7%

Таким образом, высокобелковая диета 3,4 г/кг/сут в сочетании с бодибилдинг-тренировками оказалась более предпочтительной с точки зрения изменения состава тела (рост мышц и сжигание жира). Также в высокобелковой группе не были выявлены какие-либо побочные эффекты.

Наилучшее время приёма протеина[править | править код]

Приготовление коктейля[править | править код]

Не превышайте рекомендованные порции белка, так как большие его количества просто не будут усваиваться организмом и могут привести к расстройству пищеварения. За один приём советуется употреблять не более 35 г белка. Растворяйте протеин в воде, соке или молоке, как вам больше нравится. Если вы хорошо переносите молоко, то старайтесь делать коктейли с ним, так как это увеличивает ценность белка, в молоке содержатся многие биологически-активные вещества, а также улучшаются вкусовые качества коктейля. Применяйте нежирное молоко. Подробнее читайте: Белково-углеводный коктейль.

Размер порции[править | править код]

Синтез белка в мышцах в зависимости от порции

На основании современных исследований за 2009-2012 годы (сноски приведены), размер порции должен составлять 30-35г. Конечно, допустимо превышение этих количеств, однако это совершенно нецелесообразно. Многие выступают за приём больших порций белка — до 50 и даже 60 г за один приём, однако на графике из оригинальной научной работы можно чётко увидеть, что после превышения дозы в 30 г рост уровня анаболизма в мышцах прекращается.[4]

Ещё одно исследование Symons, T. B.[5] позволило проверить влияние различных по объёму порций протеина на рост мышц. Результаты показали, что увеличение порции протеина более 30 г не приводило к большей активации синтеза мышечного белка, что подтверждает вышеперечисленные рекомендации.

Pennings B и Groen BB доказали в эксперименте, что порция размером в 35 г вызывала максимальную скорость синтеза мышечных белков, по сравнению с порциями в 10 и 20 грамм.[6]

Порция после тренировки зависит от программы и нагрузки[править | править код]
Потребность в протеине (оптимальная порция) после тренировки

Новое исследование University of Stirling[7], опубликованное в августе 2016 года позволило примирить непрекращающиеся споры об идеальной порции протеина после силовой тренировки.

Основные выводы исследований и комментарии учёных:

  1. При тренировках по сплит-программе достаточно 20-25 г протеина.
  2. При тренировках на всё тело требуется 40 г протеина для максимальной стимуляции синтеза белка в мышцах.
  3. Размер порции может также зависеть от объёма тренировки и её тяжести. Чем тяжелее тренировка, тем выше потребность.
  4. Потребность в белке не зависит от объёма мышечной массы и веса атлета.
  5. Данные выводы актуальны для здоровых не пожилых атлетов.

Полученные данные согласуются с предыдущими исследованиями, в которых небольшие порции протеина вызывали максимальный мышечный рост в тех случаях, когда прорабатывалась только часть тела по сплиту (например, только ноги). Оказалось, что определяющим фактором является не вес атлета (как многими считалось ранее), а тип и объём тренировки.

Хранение приготовленного протеинового коктейля[править | править код]

Срок хранения приготовленного протеинового коктейля зависит от условий хранения и вида протеина. К примеру если вы используете протеин с добавлением энзимов, то срок хранения может сокращаться, потому что энзимы разрушают белки и последние становятся более доступны бактериям. При комнатной температуре белковый коктейль не рекомендуется хранить более 3-4 часов, в холодильнике — более 5-6 часов. При более долгих сроках начинается сбраживание коктейля бактериями, хотя ценность протеина при этом существенно не снижается.

Возможные побочные эффекты протеина[править | править код]

Уровень достоверности Измеряемый показатель Величина эффекта Согласованность результатов исследований Заметки
+++ Жировая масса ↓ незначительный Умеренная[8][9][10][11][12][13] Добавление протеина в рацион свыше рекомендуемой суточной дозы, помогает процессу сжигания жира во время низкокалорийной диеты. Нет доказательств преимущества сывороточного протеина над другими видами
+++ Инсулин ↑ незначительный Низкая[8][10][14][15][16] Смешанные эффекты на инсулин, сыворотка повышает инсулин больше, чем другие белки. На уровень инсулина натощак как правило, либо не влияет, либо снижает
+++ Мышечная масса ↑ незначительный Умеренная[11][12][13][17] Приём протеина увеличивает мышечную массу, но доказательств о преимуществе сывороточного протеина над другим источниками немного
+++ Мощность мышц Высокая[11][13][17] Протеин не влияет на выходную мощность, хотя может усилить мощность на тренировке
+++ Вес Умеренная[8][9][10][11][12][18][19][20] Влияние сывороточного протеина на вес самого по себе весьма ненадёжно, определяется диетой. Преимуществ у сывороточного по сравнению с другими источниками белка нет
+++ Артериальное давление ↓ незначительное Очень высокая[21] Систолическое понизилось в среднем на 4 мм, диастолическое на 2,5 мм после 8 недель приёма сывороточного белка по 28 г дважды в день.
+++ Функция сосудов Улучшение Очень высокая[21] Реактивность сосудов (поток-опосредованная дилатация) и биомаркеры эндотелиальной функции
+++ Холестерин и триглицериды ↓ незначительное Очень высокая[21] После 8 недель приёма сывороточного белка по 28 г дважды в день.
++ Синтез мышечного протеина ↑↑ Значительный Очень высокая[14][22][23] Сывороточный протеин способствует увеличению синтеза мышечного белка в большей степени, чем другие источники протеина
++ Антиоксидантные ферменты ↑ незначительный[18][19] Очень высокая Повышенный уровень глутатиона вторичен по отношению к содержанию цистеина
++ Грелин ↓ незначительный Очень высокая[8] Снижение грелина при употреблении сывороточного протеина.
++ Чувствительность к инсулину ↑ незначительный Очень высокая[10][18][24] Повышение чувствительности к инсулину в большей степени, чем при употреблении казеина у лиц с ожирением, у худых спортсменов влияние не доказано
++ LDL-C ↓ незначительный Очень высокая[10] Возможно снижение LDL-C, но не доказано, что сывороточный обладает преимуществом над другими источниками белков.
++ Триглицериды ↓ незначительный Очень высокая[10][24] Возможно сокращение триглицеридов, но нет достаточных доказательств
++ Кровоток Очень высокая[25] Недостаточно доказательств в улучшение кровотока
++ Глюкоза в крови Очень высокая[8][15][16][19][24] Нет значительного влияния натощак на уровень глюкозы в крови, может уменьшить постпрандиальный уровень глюкозы за счёт высвобождения инсулина
++ Кровяное давление Очень высокая[19][25] Недостаточно доказательств влияния сывороточного протеина на уменьшение уровня кровяного давления
++ Минеральная плотность костной ткани Очень высокая[12][26] На данный момент не доказана польза для минеральной плотности костной ткани, хотя протеин в целом обладает укрепляющим эффектом
++ С-реактивный белок Очень высокая[25] Нет эффекта на С-реактивный белок
++ HDL-C Умеренная[10][19] Нет существенных доказательств увеличения HDL-C
++ ИФР-1 Очень высокая[14] Не по-видимому, по своей сути изменяют циркулирующего ИФР 1 уровень
++ Воспаление Очень высокая[25] Недостаточные доказательства взаимодействия с биомаркерами воспаления
++ Общий холестерин Очень высокая[10][24] Не оказывает существенного влияния на холестерин
+ Аппетит ↓ незначительный Очень высокая[27] Снижение аппетита (общий эффект для всех протеинов), превосходство сывороточного над другими источниками белка не доказано.
+ Кишечные проницаемость ↓ незначительный Очень высокая[28] Уменьшение проницаемости кишечника, что связано с глютамином в сывороточном протеине.
+ Ферменты печени ↓ незначительный Очень высокая[18] Уменьшение активности печёночных ферментов, но незначительно; может быть из-за содержания L-цистеина.
+ Жир в печени ↓ незначительный Очень высокая[18][24] Сокращение жира в печени при употреблении сывороточного протеина, за счёт высокого содержания L-цистеина более эффективен, чем другие источники белка

Примечание: ++++ надёжные исследования, проведённые с повторными двойными слепыми клиническими испытаниями, +++ многократные исследования, где по крайней мере, два двойных слепых плацебо-контролируемых, ++ одно исследование двойным слепым методом или нескольких когортных исследований, + только неконтролируемые или наблюдательные исследования.

Польза для сердечно-сосудистой системы[править | править код]

Было установлено, что у людей употребляющих сывороточный протеин на 8% меньше вероятность развития болезней сердца. Исследователи обнаружили уменьшение значения как систолического, так и диастолического артериального давления в течение 24-часового периода после употребления добавки. Уровни холестерина и триглицеридов, жиров, содержащихся в крови, которые, как известно, повышают риск развития сердечно-сосудистых заболеваний, также снизились. Ведущий исследователь Агнес Фекете из университета Рединга, сказала: «Результаты этого исследования очень интересные. Это показывает положительное влияние, которое молочные белки могут оказывать на кровяное давление. Долгосрочные исследования показывают, что люди, которые пьют больше молока имеют тенденцию быть более здоровыми, но до сих пор не было работы, оценившей как молочные белки влияют на кровяное давление».[29]

Польза для иммунитета[править | править код]

В состав сывороточного протеина входят: бета-лактоглобулин, альфа-лактальбумин, бычий сывороточный альбумин, лактоферрин, иммуноглобулины (например, IgA), ферменты лактопероксидазы, гликомакропептиды, витамины (такие как витамин D) и минералы, такие как Ca2+. Лактоферрин и лактоферрицин, проявляют антимикробную активность; лизосомы, лактопероксидаза, разнообразные глобулины и пептиды также вносят вклад в иммунную защиту.

Рейтинг протеинов[править | править код]

Приобретение

  1. ↑ http://www.jstor.org/discover/10.2307/25558155?uid=2&uid=4&sid=21102576159633
  2. ↑ http://spb.sovsport.ru/longread/protein_bcaa_expertiza/
  3. ↑ «A high protein diet (3.4 g/kg/d) combined with a heavy resistance training program improves body composition in healthy trained men and women – a follow-up investigation» Jose Antonio, Anya Ellerbroek, Tobin Silver, Steve Orris, Max Scheiner, Adriana Gonzalez and Corey A Peacock. Journal of the International Society of Sports Nutrition. 2015 12:39 DOI: 10.1186/s12970-015-0100-0© Antonio et al. 2015
  4. ↑ «Alert: Protein drinks / You don’t need the extra protein or the heavy metals our tests found» Consumer Reports, July 2010, p. 24-27
  5. ↑ Symons, T. B.; Sheffield-Moore, M.; Wolfe, R. R.; Paddon-Jones, D. (2009). «A Moderate Serving of High-Quality Protein Maximally Stimulates Skeletal Muscle Protein Synthesis in Young and Elderly Subjects». Journal of the American Dietetic Association 109 (9): 1582–1586.
  6. ↑ Pennings B, Groen BB, Amino acid absorption and subsequent muscle protein accretion following graded intakes of whey protein in elderly men. Am J Physiol Endocrinol Metab. 2012 Feb 14.
  7. ↑ Macnaughton L. S. et al. The response of muscle protein synthesis following whole‐body resistance exercise is greater following 40 g than 20 g of ingested whey protein //Physiological Reports. – 2016. – Т. 4. – №. 15. – С. e12893.
  8. 8,0 8,1 8,2 8,3 8,4 Baer DJ, Stote KS, Paul DR, Harris GK, Rumpler WV, Clevidence BA. Whey protein but not soy protein supplementation alters body weight and composition in free-living overweight and obese adults. J Nutr. 2011 Aug;141(8):1489-94. doi: 10.3945/jn.111.139840. Epub 2011 Jun 15.
  9. 9,0 9,1 Mojtahedi MC, Thorpe MP, Karampinos DC, Johnson CL, Layman DK, Georgiadis JG, Evans EM. The effects of a higher protein intake during energy restriction on changes in body composition and physical function in older women. J Gerontol A Biol Sci Med Sci. 2011 Nov;66(11):1218-25. doi: 10.1093/gerona/glr120. Epub 2011 Jul 27.
  10. 10,0 10,1 10,2 10,3 10,4 10,5 10,6 10,7 Pal S, Ellis V, Dhaliwal S. Effects of whey protein isolate on body composition, lipids, insulin and glucose in overweight and obese individuals. Br J Nutr. 2010 Sep;104(5):716-23. doi: 10.1017/S0007114510000991. Epub 2010 Apr 9.
  11. 11,0 11,1 11,2 11,3 Hoffman JR, Ratamess NA, Tranchina CP, Rashti SL, Kang J, Faigenbaum AD. Effect of protein-supplement timing on strength, power, and body-composition changes in resistance-trained men. Int J Sport Nutr Exerc Metab. 2009 Apr;19(2):172-85.
  12. 12,0 12,1 12,2 12,3 Kerksick CM, Rasmussen CJ, Lancaster SL, Magu B, Smith P, Melton C, Greenwood M, Almada AL, Earnest CP, Kreider RB. The effects of protein and amino acid supplementation on performance and training adaptations during ten weeks of resistance training. J Strength Cond Res. 2006 Aug;20(3):643-53.
  13. 13,0 13,1 13,2 Andersen LL, Tufekovic G, Zebis MK, Crameri RM, Verlaan G, Kjaer M, Suetta C, Magnusson P, Aagaard P. The effect of resistance training combined with timed ingestion of protein on muscle fiber size and muscle strength. Metabolism. 2005 Feb;54(2):151-6.
  14. 14,0 14,1 14,2 Reitelseder S, Agergaard J, Doessing S, Helmark IC, Lund P, Kristensen NB, Frystyk J, Flyvbjerg A, Schjerling P, van Hall G, Kjaer M, Holm L. Whey and casein labeled with L-[1-13C]leucine and muscle protein synthesis: effect of resistance exercise and protein ingestion. Am J Physiol Endocrinol Metab. 2011 Jan;300(1):E231-42. doi: 10.1152/ajpendo.00513.2010. Epub 2010 Nov 2.
  15. 15,0 15,1 Frid AH, Nilsson M, Holst JJ, Björck IM. Effect of whey on blood glucose and insulin responses to composite breakfast and lunch meals in type 2 diabetic subjects. Am J Clin Nutr. 2005 Jul;82(1):69-75.
  16. 16,0 16,1 Nilsson M, Holst JJ, Björck IM. Metabolic effects of amino acid mixtures and whey protein in healthy subjects: studies using glucose-equivalent drinks. Am J Clin Nutr. 2007 Apr;85(4):996-1004.
  17. 17,0 17,1 Weisgarber KD, Candow DG, Vogt ES. Whey protein before and during resistance exercise has no effect on muscle mass and strength in untrained young adults. Int J Sport Nutr Exerc Metab. 2012 Dec;22(6):463-9. Epub 2012 Jul 4.
  18. 18,0 18,1 18,2 18,3 18,4 Chitapanarux T, Tienboon P, Pojchamarnwiputh S, Leelarungrayub D. Open-labeled pilot study of cysteine-rich whey protein isolate supplementation for nonalcoholic steatohepatitis patients. J Gastroenterol Hepatol. 2009 Jun;24(6):1045-50. doi: 10.1111/j.1440-1746.2009.05865.x.
  19. 19,0 19,1 19,2 19,3 19,4 Sheikholeslami Vatani D, Ahmadi Kani Golzar F. Changes in antioxidant status and cardiovascular risk factors of overweight young men after six weeks supplementation of whey protein isolate and resistance training. Appetite. 2012 Dec;59(3):673-8. doi: 10.1016/j.appet.2012.08.005. Epub 2012 Aug 10.
  20. ↑ Frestedt JL, Zenk JL, Kuskowski MA, Ward LS, Bastian ED. A whey-protein supplement increases fat loss and spares lean muscle in obese subjects: a randomized human clinical study. Nutr Metab (Lond). 2008 Mar 27;5:8. doi: 10.1186/1743-7075-5-8.
  21. 21,0 21,1 21,2 Ágnes A Fekete, Carlotta Giromini, Yianna Chatzidiakou, D Ian Givens, and Julie A Lovegrove. Whey protein lowers blood pressure and improves endothelial function and lipid biomarkers in adults with prehypertension and mild hypertension: results from the chronic Whey2Go randomized controlled trialh. The American Journal of Clinical Nutrition, October 26, 2016. ttp://ajcn.nutrition.org/content/early/2016/10/25/ajcn.116.137919
  22. ↑ Pennings B, Groen B, de Lange A, Gijsen AP, Zorenc AH, Senden JM, van Loon LJ. Amino acid absorption and subsequent muscle protein accretion following graded intakes of whey protein in elderly men. Am J Physiol Endocrinol Metab. 2012 Apr 15;302(8):E992-9. doi: 10.1152/ajpendo.00517.2011. Epub 2012 Feb 14.
  23. ↑ Tipton KD, Elliott TA, Cree MG, Wolf SE, Sanford AP, Wolfe RR. Ingestion of casein and whey proteins result in muscle anabolism after resistance exercise. Med Sci Sports Exerc. 2004 Dec;36(12):2073-81.
  24. 24,0 24,1 24,2 24,3 24,4 Bortolotti M, Maiolo E, Corazza M, Van Dijke E, Schneiter P, Boss A, Carrel G, Giusti V, Lê KA, Quo Chong DG, Buehler T, Kreis R, Boesch C, Tappy L. Effects of a whey protein supplementation on intrahepatocellular lipids in obese female patients. Clin Nutr. 2011 Aug;30(4):494-8. doi: 10.1016/j.clnu.2011.01.006. Epub 2011 Feb 1.
  25. 25,0 25,1 25,2 25,3 Pal S, Ellis V. Acute effects of whey protein isolate on blood pressure, vascular function and inflammatory markers in overweight postmenopausal women. Br J Nutr. 2011 May;105(10):1512-9. doi: 10.1017/S0007114510005313. Epub 2011 Jan 28.
  26. ↑ Zhu K, Meng X, Kerr DA, Devine A, Solah V, Binns CW, Prince RL. The effects of a two-year randomized, controlled trial of whey protein supplementation on bone structure, IGF-1, and urinary calcium excretion in older postmenopausal women. J Bone Miner Res. 2011 Sep;26(9):2298-306. doi: 10.1002/jbmr.429.
  27. ↑ Lorenzen J, Frederiksen R, Hoppe C, Hvid R, Astrup A. The effect of milk proteins on appetite regulation and diet-induced thermogenesis. Eur J Clin Nutr. 2012 May;66(5):622-7. doi: 10.1038/ejcn.2011.221. Epub 2012 Jan 25.
  28. ↑ Benjamin J, Makharia G, Ahuja V, Anand Rajan KD, Kalaivani M, Gupta SD, Joshi YK. Glutamine and whey protein improve intestinal permeability and morphology in patients with Crohn’s disease: a randomized controlled trial. Dig Dis Sci. 2012 Apr;57(4):1000-12. doi: 10.1007/s10620-011-1947-9. Epub 2011 Oct 26.
  29. ↑ https://www.reddit.com/r/science/comments/5ad74e/whey_protein_supplement_significantly_lowers/

Протеин и его состав. Польза и вред. Виды. Как употреблять протеин для набора массы.

     Протеин (в переводе с анг. – белок), для простого понимания — это спортивная пищевая добавка, содержащая концентрированное количества белка в небольшой массе вещества, и определенные  микроэлементы, служит для дополнения повседневного рациона питания человека, ведущего физически активный образ жизни, недостающими питательными веществами.

      Протеин относится к одной из разновидностей современного спортивного питания и  используется в рационе питания спортсменов всех направлений. Особенно эффективна данная пищевая добавка для людей, занимающихся тяжелыми силовыми тренировками, где необходимо быстрое восстановление и прирост мышечной ткани. Свойства той или иной протеиновой смеси, позволяют быстро усваиваться организмом после тяжелых силовых тренировок, без лишнего переедания.  

Состав протеина

      Существует достаточно много разнообразий в составе протеиновых смесей. Однако во всех базовых составах протеиновых  добавок, всегда содержатся:

  • незаменимые аминокислоты
  • заменимые аминокислоты
  • витамины, минералы
  • в некоторые смеси добавляют ароматизаторы, подсластители, энзимы улучшающие усвоение    

Основную массу протеиновой смеси составляют белки  (аминокислоты) в процентном содержании которых от 60 до 95 %

протеинпротеин производится, зачастую, порошковом виде

     Аминокислоты, простым языком, это составные части из которых организмом создается  белок. Современной науке известно 20 основных аминокислот из которых собирается белок. Часть из них могут синтезироваться нашим организмом, а часть нужно восполнять извне вместе с пищей.    

     Незаменимые аминокислоты – это те которые самостоятельно не могут  создаваться нашим организмом в достаточном количестве, и их нужно получать вместе с пищей насыщенной белками. К незаменимым аминокислотам относятся такие основные три: лейцин, изолейцин, валин и еще 5 аминокислот.

протеин яичный

     Заменимые аминокислоты – это по аналогии, самостоятельно синтезируются в организме из других веществ и не требую специального получения в пище.

     Кроме аминокислот в протеиновой смеси могут содержатся минеральные и витаминные добавки. Спортивная добавка может обогащена группами витаминов С, В, Е  и прочими, может содержать кальцийсодержащие и коллагеновые включения. Перед покупкой следует смотреть на упаковке наличие дополнительных ингредиентов.

протеинв протеиновые коктейли могут добавляться витамины и натуральные красители

       Для улучшения вкуса и запаха многие производители добавляют специальные и безвредные ароматизаторы и подсластители.  Исключением безвредности таких добавок может быть индивидуальная непереносимость и аллергические реакции. Потому перед приобретением протеина необходимо ознакомится с его составом, изложенном на упаковке.

       Производится протеин в чистом порошковом виде, без дополнительных включений, подсластителей и добавок. Такой продукт дешевле и как правило содержит больший процент белка в массе. Однако при употреблении такой добавки необходимо самостоятельно обогащать ее вкусовыми свойствами и витаминами. 

протеин без вкусапротеин без добавок

Польза и плюсы протеина

Легкоусвояемый белок.

Организму нужно меньше энергии и времени для усвоения строительного белка. В частности такое свойство добавки важно после тяжелых спортивных тренировок или другой физической нагрузки, где кроме восстановления тела необходимо еще затрачивать большую часть энергии на переваривание тяжелой пищи.

протеин без вкусапротеин помогает быстрее восстановиться после тренировки

Способствует набору сухой мышечной массы.

Ускоряет восстановление мышечной ткани после нагрузок и ее приросту. Таким образом, способствует более быстрому росту силы и выносливости.

Дает возможность потреблять суточную норму белка, без переедания и перегрузки пищеварительной системы.

Нормой потребления белка для человека средней физической активности является 1,5-2 г на 1 кг массы тела. Для людей активно занимающимися тяжелыми физическим нагрузками, эта норма возрастает в 2 раза и составляет от 2 до 3 грамм на 1 кг массы тела. Такой объем пищи усвоить достаточно трудно организму, потому протеиновая добавка служит хорошим помощником при восстановлении сил.

протеин без вкуса

Хорошая альтернатива к употреблению мяса.  

Для людей, которые не любят употреблять мясные продукты, это идеальный вариант. Протеиновые добавки служат хорошей альтернативой для восполнения незаменимых аминокислот, которые организм получал вместе с мясными продуктами.

Удобен в транспортировке и хранении.

Протеин не является быстро портящимся продуктом. В отличие от яиц и творога, насыщенных белком, протеин не нужно хранить в холодильнике и не нужно опасаться, что он испортится. У протеинового порошка, как и у любого продукта, есть свой срок годности, он составляет от нескольких месяцев до полутора лет. Что бы сохранить  протеин в пригодном для употребления состоянии достаточно хранить его в сухой емкости, в условиях практически любой температуры.  

протеин без вкусапротеин удобен в хранении

Натуральный продукт.

Протеин в чистом виде изготовлен из натуральных продуктов природного происхождения, без химических добавок и прочих компонентов, ведь это как минимум вредило бы самому принципу здорового образа жизни. Конечно среди производителей протеиновых добавок имеются исключения, которые позволяют себе включать разного рода химические соединения для отдельной категории людей, которые занимаются физическими нагрузками уже не для здоровья, а для совсем иных целей. Но таких продуктов мало и встретить их в рядовом магазине спортивного питания большая редкость. Стоимость такого модифицированного протеина значительно выше обычной белковой добавки.   

протеин без вкусапротеин изготавливается только из натуральных продуктов

Экономит время и средства.

Для готовки протеинового коктейля не нужно что то размораживать, жарить, варить и выполнять другие кулинарные действия. Достаточно засыпать в герметизированную емкость необходимый объем порошка , залить его водой или иной жидкостью. Интенсивно взболтав, в течении нескольких секунд, жидкую смесь можно выпить.  Это хорошая и эффективная, для физического развития, альтернатива быстрому перекусу между основными приемами пищи. Употребление протеина, при скрупулёзных подсчетах, оказывается дешевле получения необходимого количества белка только из животных продуктов.

      Важно всегда помнить что, употребление протеиновых смесей не может заменять полноценный прием пищи, а служит лишь дополнением к основному рациону питания!!!

протеин без вкусапротеин не может заменить полноценный прием пищи и должен потребляться в комплексе с обычным питанием

Недостатки и возможный вред протеина

Наличие дополнительных ингредиентов.

Не всегда красители и подсластители которые присутствуют в протеиновых коктейлях, могут принести пользу. Сахара, в том или ином виде не способствует похудению. Кроме того, в протеиновых смесях содержится. Например, подсластители могут замедлять процесс похудения. Поэтому тем, кто хочет получить 100% безопасный продукт, следует приобретать чистый порошок без примесей. Такой протеин не имеет вкуса, его можно использовать в приготовлении обычных блюд.

протеин без вкусацвет протеина зависит от добавки

Не подходит для похудения.

Протеиновый коктейль, как спортивное питание,  это скорее продукт для набора мышечной массы, поскольку в свой состав включает определенное количество углеводов и жиров. Употреблять, конечно его можно во время похудения, но процесс снижения веса будет не столь интенсивен, как бы хотелось. Для похудения больше подходит другой вид спортивного питания – это аминокислоты в чистом виде, такие как ВСА. Подробнее про способы похудения.

протеин без вкуса

Аллергические реакции.

Это крайне редкое явление, но имеет место быть. Касается этот недостаток отдельной категории людей с индивидуальной непереносимостью дополнительных включений в состав протеина. Потому, аллергикам рекомендуется внимательно ознакомится с составом смеси на упаковке, перед ее приобретением и употреблением в пищу.

протеин без вкусаупотребление протеина поможет больше в наборе мышечной массе, чем в похудении

Расстройство желудка.

Расстройство пищеварения может вызвать только индивидуальная непереносимость того или иного пищевого продукта из которого выделен протеин. Например: непереносимость лактозы, в случае с сывороточными и протеинами на основе молочных продуктов. Так же чрезмерное употребление белковой пищи у определенной категории людей может вызвать легкое расстройство желудка. Такая реакция организма, может послужить полезным сигналом, что необходимо снизить объем потребляемого белка. Ведь излишки протеина не усваиваются, а выводятся из организма через кишечник и в данном случае Вы понапрасну тратите ценный продукт.   

протеин без вкусаиндивидуальная непереносимость и избыток белка может вызвать расстройство желудка

Избыточное употребление может затруднять работу печени и почек.

Данный недостаток может влиять только на людей с нарушением работы почек и печени. Это свойство присуще не исключительно протеину как спортивному питанию, а касается всех пищевых продуктов с высоким содержанием белка.

протеин без вкусачрезмерное употребление протеина не принесет пользы

Высокая стоимость некоторых смесей.

Не весь спортивный протеин достаточно дешево стоит. Отдельные виды смесей не будут доступны всем категориям людей для регулярного потребления. Зачастую, это протеин иностранного производства, либо же смеси с многочисленными уникальными добавками или же «раскрученные бренды». Но по этому поводу расстраиваться не стоит. Эффективную альтернативу может составить обычный протеин без подсластителей и ароматизаторов, который будет не хуже его дорогих аналогов, если Вы реально нацелены на результат.   

протеин без вкуса

Виды протеина

По скорости усвоения

Быстроусвояемый протеин.

Содержит расщепленный белок который усваивается организмом уже в первые 40-60 мин. Эффективен для употребления сразу после тренировок, после тяжелых и интенсивных физических нагрузок. К такой категории относится сывороточный протеин, молочный и яичный протеины.

Медленноусвояемый протеин.

Усваивается от 2 до 5 часов. Используется для насыщения организма белком в течение длительного времени. Усваивается постепенно и более длительное время в течение дня. Рекомендуется выпивать в промежутках между приемами пищи. Используется как дополнительная белковая добавка, в случае невозможности получить необходимое количество белка из обычного рациона питания.  К данному виду относятся соевый, казеиновый и мясной протеины.

протеин без вкуса

По сырью производства протеины разделяют на:

Сывороточный протеин

   Самая популярная разновидность протеиновой смеси.  Изготавливается из молочного белка. Содержит много аминокислот, в том числе и незаменимые аминокислоты. Относится к быстроусвояемым протеинам. Имеет более дешевую стоимость в сравнении с другим видами, из за простоты производства. Из минусов: содержит лактозу  молочный сахар, потому может не подойти людям которые не переносят и плохо усваивают лактозу.

     Хорошо подходит для после тренировочного употребления , как материал для быстрого восстановления мышц.

протеин без вкуса

Яичный протеин

       Второй по популярности протеин, после сывороточного. Так же, относиться к легко и быстроусвояемым белкам. Содержит почт все виды аминокислот. Изготавливается из яичного белка. Не содержит сахара и лактозы, но может содержать дополнительные вкусовые добавки на основе сахара. Рекомендуется выпивать яичный протеин, после тренировки, что способствует более быстрому восстановлению поврежденных мышц. Так же может использоваться в период снижения веса, однако при условии отсутствия дополнительных вкусовых добавок на основе сахаров.  

протеин без вкусаяичный протеин

Казеиновый протеин

       Так же как и сывороточный протеин, изготавливается из молока. Казеин – это разновидность молочного белка, и образует в молочном продукте соль кальция. Относится к долго и медленноусвояемым протеиновым смесям. Это время составляет примерно  5 часов. Длительный процесс усвоения обеспечивает равномерное и постепенное снабжение организма белком, в течение продолжительного времени.  Подходит для употребления в течение дня между основными приемами пищи, между тренировками и пред сном.  Придает ощущение сытости. Хорошо подойдет для набора мышечной массы.

протеин без вкусаказеиновый протеин

Мясной протеин

       Изготавливается из говяжьего белка. Насыщен натуральным креатином, содержит до 90% белка. По своим характеристикам не уступает яичному и сывороточному протеинам, однако имеет один недостаток – боле высокую стоимость, которая обусловлена сложностью производства. Потому менее популярен.  Хорош подходит для набора мышечной массы, но не будет эффективен при похудении.

протеин без вкуса

Растительный протеин

       К данной категории относятся все протеиновые смеси, изготовленные на основе продуктов растительного происхождения. Самыми распространёнными являются такие виды растительного протеина как: соевый протеин, гороховый протеин и реже овсяный протеин. Может составить хорошую альтернативу для людей, не употребляющих в пищу мясо, поскольку содержит только растительный белок и не содержит животных белков и жиров. Усваивается быстрее животного белка, до 5 часов, но медленнее сывороточного протеина. Подробнее про растительный белок.

      Кроме насыщения организма белком, растительные протеины оказывают дополнительную пользу для организма:

  • способствует расширению кровеносных сосудов, улучшению тока крови и быстрому метаболизму
  • растительный протеин не несет холестерин в организм
  • улучшает работу щитовидной железы
  • дополнительно снабжает витаминами и минералами

Растительный протеин целесообразно употреблять во время всего дня и на ночь, поскольку он относится к долгоусвояемым.   

протеин без вкусасоевый протеин

Употребление протеина для набора мышечной массы

    Для эффективного набора мышечной массы, прежде всего, необходимо сочетать силовые физические нагрузки и белково-углеводное питание. С потреблением углеводов, как правило, никогда проблем не возникает, зачастую их потребляется больше нормы. Что нельзя утверждать про белковую пищу. Именно нехватка белковых продуктов, даже в условиях тяжелых и регулярных физических нагрузок, может стать серьезным препятствием для быстрого роста и восстановления мышц. Ведь белок (протеин) – это строительный материал для наших мышц и тела в целом.  

     Для набора мышечной массы можно использовать как быстроусвояемые, так и медленно усвояемые протеины. Идеальным вариантом, будет их комбинация во время всего дня.

протеин без вкуса

До и после тренировки.

    Примерно за 40 мин до силовой тренировки рекомендуется выпить одну порцию быстрого протеина ( сывороточного или яичного). Сразу же после тренировки такую же порцию необходимо употребить для снабжения организма строительным материалом. Как вариант, можно использовать аминокислоты в чистом виде ВСА, о которых мы поговорим отдельно.

Опыт из практики:

    Для более эффективного и быстрого усвоения протеиновой смеси, белковый коктейль необходимо сочетать с быстрыми углеводами с содержанием сахара природного происхождения: один банан, яблоко и прочие фрукты.   

как пить протеин

     Дополнительные легкие углеводы дадут энергии организму быстро справится со всем объемом поступивших белков.

     Протеин длительного времени усвоения можно употреблять в течении всего дня, в объемах согласно рекомендациям, указанным на упаковке, утром, между приемами пищи и на ночь.  

 Не рекомендуется:

  • употреблять протеин вместе с алкоголем или при наличие его остатков в желудке и крови. Никакого вреда это не принесёт, однако эффективность такого употребления будет равна нулю. Поскольку белок практически не усвоится и в сочетании с алкоголем свернется.
  • смешивать протеиновый коктейль с кипятком или парящей горячей водой. Под воздействием высоких температур, белок утрачивает свою структуру и распадается. Так же как и при воздействии алкоголя, протеин сворачивается и меняет свою структуру.
как пить протеинсмешивать протеиновый коктейль необходимо в жидкости средней температуры

     Чрезмерное употребление протеина не даст дополнительного результата и не вызовет каких-либо неблагоприятных реакций. Вы просто потратите продукт впустую.

Рекомендованная норма употребления белка в сутки:

  • 1,5 г на 1 кг собственного веса, для человека со средней физической активностью
  • 2 – 2,5 г на 1 кг собственного веса, для людей систематически и регулярно занимающихся силовыми тренировками и спортом.
  • от 3 г на 1 кг собственного веса, уже норма потребления для профессиональных спортсменов.   
как пить протеин

     

Протеин – натуральная, белковая пищевая добавка к рациону питания любого физически активного человека. Это хороший белковый помощник для питания человека, в жизни которого много физической нагрузки и мало времени. Однако белковые коктейли, как и любые полезные продукты, будут наиболее эффективными в комплексе с полноценным питанием, с равномерным употреблением жиров, углеводов, витаминов и минералов.  

Виды протеина: цель применения для похудения

Виды протеина и их различияВиды протеина и их различия

 

Сегодня нам предстоит изучить виды протеина, применение, их различия. Протеин еще называют – белок. Белковые добавки часто принимают люди, активно занимающиеся спортом, при этом желающие похудеть.

Что такое протеин:

Содержание статьи

 

Протеин является питательным веществом, который находится во многих видах пищи. Например, мясо, в молочных продуктах, орехах или бобовых крупах.

Белки состоят из более мелких молекул, называемых аминокислотами. Они являются строительными молекулами наших костей, кожи, волос, ногтей, мышц.

Организм человека состоит из 15% белка. Он постоянно необходим организму. Кроме того, он влияет на правильную регенерацию, гормональный баланс человека.

Важным моментом для нас является тот факт, что человеческий организм не может накапливать такой фермент для хранения. Следовательно, нет превращения белка в жировую ткань.

Лучше всего обеспечивать организм коллагеном из пищи. В случае большей потребности в этом ингредиенте, удобнее добавлять в меню белковый порошок.

Его готовят в виде напитка, который легко пить. Протеиновые добавки могут использовать все люди, которые испытывают дефицит коллагена в своем рационе – едят мало мяса, яиц, творога или сыра.

Вегетарианцы могут использовать соевые, рисовые, гороховые белковые добавки. Протеины нужны людям, у которых есть проблемы с перевариванием мяса или яиц.

 

Животный, растительный белок:

 

Виды животного и растительного протеинаВиды животного и растительного протеина

 

Аминокислоты, которые организм не может производить самостоятельно, называются незаменимыми, поэтому мы должны принимать их с пищей.

Белки, которые содержат все 10 незаменимых аминокислот, являются полезными веществами. Все незаменимые аминокислоты находятся в животном белке. Растительный белок является неполноценным продуктом, не содержит все незаменимые аминокислоты.

В этом нет ничего удивительного. Данный компонент является абсолютно необходимым элементом диеты, если человек желает развивать свои мышцы.

 

Цель применения протеинов:

 

Протеин – один из самых ценных питательных веществ в рационе каждого человека. Является основным строительным материалом для мышечной, нервной, железистой ткани. Дефицит белка в рационе приводит к угнетению физического, психического развития человека.

Снижает устойчивость к инфекционным заболеваниям. Повышенная потребность в протеине наблюдается у детей, подростков, кормящих женщин, спортсменов.

С помощью белковой пищи у спортсменов происходит быстрое восстановление, регенерация мышечной ткани. В дополнение к «строительному», восстанавливающему аспекту, данное вещество обладает свойствами бороться с лишним весом.

Имеется в виду, так называемую отрицательную калорийность баланса белковых продуктов. Дело в том, что энергия, необходимая для их переваривания, выше, чем та, которую доставляет нашему телу данный продукт.

Поэтому, если вы хотите сбросить лишние килограммы, увеличьте долю белка в своем рационе. Это усилит сжигание калорий в покое!
Сейчас продают разные виды протеина в виде добавок к пище. Теперь самое время познакомиться с видами протеина.

 

Виды сывороточного протеина:

 

Виды протеина, сывороточныйВиды протеина, сывороточный

 

Самый популярный вид — сывороточный белок. Его получают, как нетрудно догадаться, из сыворотки, которая остается от производства сыра. Это продукт животного происхождения.

 

Как производят:

 

Чтобы получить такое питательное вещество, производители подвергают сыворотку процессу ультрафильтрации. Очищают ее от жира, лактозы (молочного сахара).

Продукт, полученный от процесса очистки, называют концентратом сывороточного белка WPC. Характеризуется отличным, быстрым действием. Как правило, процент белка в таком питательном веществе колеблется в пределах 70-80%.

 

Изоляты, гидролизаты:

 

Вид сывороточного белка, гидролизатВид сывороточного белка, гидролизат

Гидролизат

Концентрат, не единственная форма сыворотки. В зависимости от степени его очистки выпускают: изоляты, гидролизаты сывороточного протеина.

 

Вид сывороточного белка, изолятВид сывороточного белка, изолят

Изолят

Эти формы мгновенно усваиваются, лишены напрочь содержания углеводов, жиров. Доля самого белка колеблется от 85% до 96-97%. Они дороже самого сывороточного протеина WPC.

В связи с быстрым усвоением этой формы продукта, его рекомендуется употреблять после физических нагрузок или утром. Можно принимать в качестве дополнения или замены приемов пищи в течение дня.

Нужно следить, чтобы интервалы между приемами не превышали 3 часов.

 

Казеин:

 

Виды белка, казеинВиды белка, казеин

 

Казеин, имеет молочное происхождение, составляет 3⁄4 всех белков молока. Содержит 80% белка, не содержит лактозы. Подходит для похудения.

Потреблять можно вместо ужина. Обеспечивает сытость на долгое время – до 8 часов. Можно заменять им перекусы. При этом всем необходимым составом аминокислот данный продукт обладает в полной мере.

Отличается от сывороточного продукта временем переваривания, усвоения. Поскольку он переваривается дольше, его нужно есть перед сном. Принимать после тренировки лучше сывороточный протеин, он усваивается быстрее. Казеин стоит дороже сывороточного продукта.

 

Яичный протеин:

 

Упаковка яичного протеинаУпаковка яичного протеина

 

Из названия понятно, что его получают из яиц. После отделения желтков, обезвоживания белков образуется протеиновый порошок. Содержит много витаминов, минералов.

К сожалению, его нельзя использовать людям, страдающим аллергией на яичный белок. По цене, данный вид продукции дороже других.

 

Соевый:

 

Упаковка с соевым белкомУпаковка с соевым белком

 

Соя является единственным растительным источником белка, который содержит все незаменимые аминокислоты. Такой вид питания поддерживает сопротивляемость организма, здоровье костей.

Соевые бобы полезны при сердечно-сосудистых заболеваниях, снижают риск развития рака. Соя содержит много аргинина, который ускоряет регенерацию мышц после тренировки.

Соевые продукты очень противоречивы, особенно по воздействию на уровень тестостерона у мужчин, мужской фертильности, функции щитовидной железы.

Будьте осторожны – чрезмерное потребление сои может привести к гормональным нарушениям. В наше время соевый белок добавляют во многие продукты поэтому, выбирая себе вид протеина, учитывайте этот факт.

Соевый продукт может вызывать аллергию у людей, страдающих аллергией на сою. При этом, является хорошей заменой, если у вас аллергия на лактозу или яичный продукт.

 

Мясной вид протеина:

 

Продукция в упаковке с мясным протеиномПродукция в упаковке с мясным протеином

 

Его готовят из сухожилий, хрящей, что подтверждается его аминокислотным составом. Имеет схожую питательную ценность с растительными белками.

Содержит мало жира. Не хватает в составе некоторых незаменимых аминокислот.

 

Различия протеинов:

 

Самая важная особенность, отличающая казеин от сыворотки, заключается в том, что он переваривает до 8 часов, обеспечивая поступление аминокислот в организм.

Он прекрасно работает вместо последнего приема пищи на ночь, обеспечивая доставку аминокислот в мышцы во время сна. Казеин подходит для питания, если у нас будут большие перерывы между приемами пищи.

Является прекрасным «наполнителем» желудка, защищая организм от лишних перекусов. Сыворотка используется для тренировок или в течение дня.

Концентрат — самая дешевая протеиновая добавка, гидролизат — самый дорогой продукт. Почему такие различия? Содержанием белка. 70-85% этого ингредиента содержится в концентрате, до 95% — в изоляте.

Белок из концентрата всасывается медленнее, чем из изолята, гидролизата. Концентраты, изоляты сывороточного белка получают путем микрофильтрации или ионного обмена.

В гидролизате, белки дополнительно подвергаются гидролизу, то есть «расщеплению» длинной белковой цепи на гораздо меньшие полипептиды.

Это означает, что аминокислоты из этого препарата поглощаются быстрее – в течение 15-60 минут после потребления. Гидролизат содержит почти 100% белка, не имеет в составе подсластителей, поэтому имеет горький вкус.

Концентрат, характеризуется самой высокой долей углеводов, жиров среди трех видов протеина. Будет ли это вид изолята или концентрата, будет зависеть от того, на какой продукт хватит нашего кошелька.

Лучшим вариантом будет концентрат, хотя, если вы заботитесь о самом чистом продукте, нужно предпочесть изоляты. Если вам нужно чувствовать себя сытым долгое время, выбирайте казеин.

Медленно усваиваемые белки – казеин, яичный белок. Концентраты сывороточного белка имеют промежуточное время всасывания.

Следует помнить, что протеины является добавкой к питанию. Предназначены только для дополнения диеты, а не для полной замены ежедневных приемов пищи.

 

Кому и как применять:

 

Вид и количество белковой добавки следует подбирать в соответствии с уровнем активности, целью тренировки. Для людей, тренирующихся раз в неделю, достаточно одной порции белка в день во время еды.

Есть после тренировки. Порция обычно 30 г. Производители кондиционеров прикрепляют к своим продуктам мерные ложки, которые позволяют легко отмерить нужное количество.

Людям, которые тренируются для общего активного состояния один раз в неделю, вообще не нужна протеиновая добавка.

При тренировках 2-3 раза в неделю для общей физической подготовки, достаточно одной порции добавок в день после тренировки. Рекомендуются препараты, содержащие смесь изолята, концентрата сывороточного белка.

  1. Для тренировок более 3 раз в неделю, рекомендуется 2 порции смеси различных добавок в день.
  2. Для повышения энергии, рекомендуется использовать концентрат сывороточного белка. Лучше всего использовать 2 порции – одну после тренировки, другую – во время любой еды.
  3. Люди, которые снижают вес, могут использовать две порции добавок. Рекомендуется принимать в форме изолята или 2-3 порции в день изолята, концентрата.
  4. Если ваша диета состоит из продуктов богатых коллагеном, использование более 1 порции добавок не требуется.

 

Как принимать: 

 

Разрешены на завтрак – оладьи с добавлением любого вида протеина.
Перед тренировкой – примерно за 1 час до занятий можно съесть порцию концентрата или смесь изолята с ним.
После тренировки – большое количество белковых ферментов поступает во время «анаболического окна». Это примерно через 30–60 минут после тренировки. Таким образом, ускоряется регенерация, рост мышц. Для этого подходит концентрат сыворотки.
Между приемами пищи — если прием пищи был недостаточно питательным или между приемами пищи произошел длительный перерыв, можно использовать казеин или смесь разных продуктов.
Перед сном – когда ночью мучает сильный голод, применяйте на ужин казеин.

 

Для похудения:

 

Простое использование добавок без изменения диеты, увеличения физической активности не оказывает эффекта похудения. Чтобы сжигать запасы энергии, жировой ткани, в организме должен быть дефицит калорий.

Все-таки некоторый эффект есть и без физкультуры. Процесс потери веса идет быстрее. Быстрее уменьшается процент жира. Увеличивается мышечная масса.

Прием изолята сывороточного белка в течение 12 недель улучшает уровень инсулина натощак. Снижает резистентность к инсулину у людей с избыточным весом, ожирением.

Улучшенная чувствительность к инсулину повышает эффективность от соблюдаемой диеты.

 

Как выбрать протеин:

 

Основным критерием при выборе добавки должно быть содержание белка в препарате. Оно должно быть не менее 80%. Следует обратить внимание на количество эндогенных (организм может их производить) и экзогенных аминокислот (обеспечивается диетой).

Полезность питательного вещества для развития мышц в основном определяется наличием незаменимых (экзогенных) аминокислот. Известные всем аминокислоты лейцина, изолейцина, фенилаланина, лизина.

А также – метионина, треонина, триптофана, валина. Обратите внимание на содержание относительно экзогенных аминокислот: аргинина, гистидина.

 

Количество аминокислот мг/г. (примерные цифры):

 

  • Изолейцин: 49,7-57,3.
  • Лейцин: 79,8-106,6.
  • Валин: 18,4-59,3.
  • Лизин: 76,1-88,1.
  • Метионин, цистеин (с серой): 79,7 в целом, примерно равное количество.
  • Фенилаланин, тирозин (ароматический): 58,2 всего, примерно равные количества.
  • Треонин: 61,1-68,7.
  • Триптофан: 17.3.
  • Гистидин: 7,8-18,7.
  • Аланин: 42,1-55,5.
    Аргинин: 22,0-27,1.
    Глутамин:141,4-158,4.
  • Глицин: 13,8-53,2.
  • Пролина: 46,7-66,6.
  • Серин: 38,8-53.
  • Аспарагиновая кислота: 94,1.

Упаковка питательных веществ содержит информацию о биологической ценности используемого продукта.

 

Биологическая ценность белков:

 

  • Изолят: 159.
  • Концентрат сывороточного белка: 104.
  • Лактальбумин (молочный белок): 104.
  • Яичный: 88.
  • Куриная грудка: 79.
  • Казеин: 77.
  • Соевый: 75.
  • Картофельный: 60.

В хороших добавках не должно быть таурина или креатина. Нежелателен сахар в различных формах — глюкоза, сахароза, глюкознофруктозный сироп.

В питательных веществах молочного происхождения (сыворотка, казеин) часто присутствует лактоза – молочный сахар. Она у многих людей вызывает пищевую непереносимость в виде вздутия живота, образования газов, диареи.

При выборе вкуса, учитывайте наличие аромата, подсластителя. Список дополнительных ингредиентов должен быть небольшим.

Некоторые производители добавляют только 4 ингредиента в упаковку. Если имеются эмульгаторы, они безвредны. Хорошо способствуют растворению, предотвращают образованию пены добавки.

Необходимо учитывать перевариваемость белка. Животные протеины достигают цифр в 90%. Усвояемость продукции из растений – 60-80%.

Чтобы добиться желаемого результата, растительного протеина, понадобится на порядок больше.

Влияние протеина на здоровье:

 

Лучше всего влияет на здоровье человека сывороточный протеин. Он содержит иммуноглобулины. Было подтверждено, что он стимулирует иммунную систему.

  • Помогает снизить процент общего и ЛПНП холестерина у женщин и мужчин с ожирением.
  • Влияет на снижение артериального давления у людей с гипертонией.
  • Снижает риск инсульта, инфаркта у человека.
  • Понижает уровень инсулина натощак.
  • Улучшает чувствительность к инсулину.
  • Этот эффект не был подтвержден для употребляющих казеин людей.
  • Стимулирует выработку мощного антиоксиданта глутатиона.

Побочные эффекты от применения протеинов:

 

 

Белковые добавки, используемые в соответствии с потребностями организма, оказывают на него полезное воздействие. Однако бывают случаи передозировки. Это, например, прием более 3 г. на килограмм веса тела в день.

 

Какие побочные эффекты может вызвать чрезмерное потребление добавок?

  • Избыток белка печень превращает в глюкозу – энергетический материал.
  • При соответствующих условиях он превращается в триглицериды, являющиеся компонентом жировой ткани.
  • Образуются ненужные продукты жизнедеятельности, которые должны выводиться из организма в основном с мочой.
  • Увеличение мочеиспускания в сочетании с физическими упражнениями приводят к хроническому обезвоживанию нашего тела.
  • Может произойти увеличенное выделение кальция с мочой, что приводит к декальцинации костей.
  • Увеличивается риск развития почечных оксалатных камней.
  • Риск заполучить подагру увеличивается.
  • В кишечнике происходит чрезмерное накопление газов.

 

Знайте:

 

1 г белка составляет около 4 ккал.
Ежедневное потребление белка должно составлять около 1 г. на килограмм веса тела.
Выбирайте полезные животные белки, ешьте разные семена, орехи.

Если ваши занятия физкультурой очень интенсивные, нужно увеличить количество белковых веществ в рационе, чтобы обеспечить правильное функционирование всех метаболических процессов.
Пожалуй, этого достаточно, чтобы узнать виды протеина, цели его применения для любого человека.
Будьте здоровы всегда!
С уважением, Светлана Э.

Поделиться ссылкой:

Протеин Spike / белок S

Spike-белок (S-белок) представляет собой крупный трансмембранный белок I типа, содержащий от 1160 аминокислот для вируса птичьего инфекционного бронхита (IBV) до 1400 аминокислот для коронавируса кошек (FCoV) (рис. 1). Кроме того, этот белок сильно гликозилирован, поскольку содержит от 21 до 35 сайтов N-гликозилирования. Белки-шипы собираются в тримеры на поверхности вириона, образуя характерную «корону», или подобие короны. Эктодомен всех шиповых белков CoV имеет одинаковую организацию в двух доменах: N-концевой домен, названный S1, который отвечает за связывание рецептора, и C-концевой домен S2, ответственный за слияние (рис. 2).Разнообразие CoV отражается в вариабельных белках-шипах (S-белки), которые эволюционировали в формы, различающиеся их рецепторными взаимодействиями и их реакцией на различные триггеры окружающей среды слияния вирус-клеточная мембрана.

Сообщается, что 2019-nCoV может инфицировать респираторные эпителиальные клетки человека посредством взаимодействия с человеческим рецептором ACE2. Действительно, рекомбинантный белок Spike может связываться с рекомбинантным белком ACE2.

Заметное различие между белками-шипами разных коронавирусов заключается в том, расщепляется ли он во время сборки и экзоцитоза вирионов.За некоторыми исключениями, в большинстве альфа-коронавирусов и бета-коронавируса SARS-CoV вирионы содержат нерасщепленный спайковый белок, тогда как в некоторых бета- и всех гаммакоронавирусах белок расщепляется между доменами S1 и S2, как правило, фурином, Гольджи. -резидентная протеаза хозяина. Интересно, что среди видов вируса гепатита мышей бета-коронавируса (MHV) разные штаммы, такие как MHV-2 и MHV-A59, проявляют разные требования к расщеплению. Это имеет важные последствия для их фузогенности.


Рисунок 1. Спайковый белок коронавируса ,

PHIP — PH-взаимодействующий белок — Homo sapiens (Человек)

> sp | Q8WWQ0 | PHIP_HUMAN PH-взаимодействующий белок OS = Homo sapiens OX = 9606 GN = PHIP PE = 1 SV = 2
MSCERKGLSELRSELYFLIARFLEDGPCQQAAQVLIREVAEKELLPRRTDWTGKEHPRTY
QNLVKYYRHLAPDHLLQICHRLGPLLEQEIPQSVPGVQTLLGAGRQSLLRTNKSCKHVVW
KGSALAALHCGRPPESPVNYGSPPSIADTLFSRKLNGKYRLERLVPTAVYQHMKMHKRIL
GHLSSVYCVTFDRTGRRIFTGSDDCLVKIWATDDGRLLATLRGHAAEISDMAVNYENTMI
AAGSCDKMIRVWCLRTCAPLAVLQGHSASITSLQFSPLCSGSKRYLSSTGADGTICFWLW
DAGTLKINPRPAKFTERPRPGVQMICSSFSAGGMFLATGSTDHIIRVYFFGSGQPEKISE
LEFHTDKVDSIQFSNTSNRFVSGSRDGTARIWQFKRREWKSILLDMATRPAGQNLQGIED
KITKMKVTMVAWDRHDNTVITAVNNMTLKVWNSYTGQLIHVLMGHEDEVFVLEPHPFDPR
VLFSAGHDGNVIVWDLARGVKIRSYFNMIEGQGHGAVFDCKCSPDGQHFACTDSHGHLLI
FGFGSSSKYDKIADQMFFHSDYRPLIRDANNFVLDEQTQQAPHLMPPPFLVDVDGNPHPS
RYQRLVPGRENCREEQLIPQMGVTSSGLNQVLSQQANQEISPLDSMIQRLQQEQDLRRSG
EAVISNTSRLSRGSISSTSEVHSPPNVGLRRSGQIEGVRQMHSNAPRSEIATERDLVAWS
RRVVVPELSAGVASRQEEWRTAKGEEEIKTYRSEEKRKHLTVPKENKIPTVSKNHAHEHF
LDLGESKKQQTNQHNYRTRSALEETPRPSEEIENGSSSSDEGEVVAVSGGTSEEEERAWH
SDGSSSDYSSDYSDWTADAGINLQPPKKVPKNKTKKAESSSDEEEESEKQKQKQIKKEKK
KVNEEKDGPISPKKKKPKERKQKRLAVGELTENGLTLEEWLPSTWITDTIPRRCPFVPQM
GDEVYYFRQGHEAYVEMARKNKIYSINPKKQPWHKMELREQELMKIVGIKYEVGLPTLCC
LKLAFLDPDTGKLTGGSFTMKYHDMPDVIDFLVLRQQFDDAKYRRWNIGDRFRSVIDDAW
WFGTIESQEPLQLEYPDSLFQCYNVCWDNGDTEKMSPWDMELIPNNAVFPEELGTSVPLT
DGECRSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMYCTVV
AYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFI
KDQTCYNIIPLYNSMKKKVLSDSEDEEKDADVPGTSTRKRKDHQPRRRLRNRAQSYDIQA
WKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPME
LCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTITKR
RKKRNRSSSVSSSAASSPERKKRILKPQLKSESSTSAFSTPTRSIPPRHNAAQINGKTES
SSVVRTRSNRVVVDPVVTEQPSTSSAAKTFITKANASAIPGKTILENSVKHSKALNTLSS
PGQSSFSHGTRNNSAKENMEKEKPVKRKMKSSVLPKASTLSKSSAVIEQGDCKNNALVPG
TIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVH
PIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLRR
SNRKKIDDPIDEEEEFEELKGSEPHMRTRNQGRRTAFYNEDDSEEEQRQLLFEDTSLTFG
TSSRGRVRKLTEKAKANLIGW
 
.

CRP — Предшественник C-реактивного белка — Homo sapiens (Человек)

CRP

Homo sapiens (Человек)

Оценка за аннотацию:

Оценка за аннотацию: 5 из 5

Оценка аннотации обеспечивает эвристический критерий содержания аннотации записи или протеома UniProtKB. Эту оценку нельзя использовать в качестве меры точности аннотации, поскольку мы не можем определить «правильную аннотацию» для любого данного белка.

Подробнее …

-Экспериментальные данные на уровне белка и

Это указывает на тип доказательств, подтверждающих существование белка. Обратите внимание, что свидетельство «существования белка» не дает информации о точности или правильности отображаемых последовательностей.

Подробнее …

Выберите раздел слева для просмотра содержимого.

В этом разделе представлена ​​вся полезная информация о белке, в основном биологическая информация.

Подробнее …

Function i

Выполняет несколько функций, связанных с защитой хозяина: способствует агглютинации, набуханию бактериальной капсулы, фагоцитозу и фиксации комплемента за счет своего кальций-зависимого связывания с фосфорилхолином. Может взаимодействовать с ДНК и гистонами и может очищать ядерный материал, высвобождаемый из поврежденных циркулирующих клеток.

Разное

Этот белок обязан своим названием своей способности осаждать пневмококковый C-полисахарид в присутствии кальция.

В этом подразделе раздела «Функция» представлена ​​информация, относящаяся к кофакторам. Кофактор — это любое небелковое вещество, необходимое для того, чтобы белок был каталитически активным. Некоторые кофакторы неорганические, такие как атомы металлов цинка, железа и меди в различных степенях окисления. Другие, например большинство витаминов, являются органическими.

Подробнее …

Кофактор i
Ca 2+ Примечание: связывает 2 иона кальция на субъединица.
Сайты
Функциональный ключ Позиция (я) Описание Действия Графический вид Длина

В этом подразделе раздела Функция указано, в каком положении белок связывает данный ион металла.Тип металла указан в поле «Описание».

Подробнее …

Металлический переплет и
78 Кальций 1

Проверенная вручную информация, созданная автоматической системой аннотаций UniProtKB.

Подробнее…

Ручное утверждение по правилам i

1
Металлическое переплетение i 79 Calcium 1

Ручное утверждение согласно правилам i

1
Металл привязка i 156 Calcium 1

Ручная установка в соответствии с правилами i

1
Металлическая привязка i 156 Calcium 2

Ручная установка согласно правилам i

1
Металлическое переплетение i 157 Кальций 1; через карбонильный кислород

Ручная установка согласно правилам i

.

IK — Protein Red — Homo sapiens (Человек)

IK

Homo sapiens (Человек)

Оценка за аннотацию:

Оценка за аннотацию: 5 из 5

Оценка аннотации обеспечивает эвристический критерий содержания аннотации записи или протеома UniProtKB. Эту оценку нельзя использовать в качестве меры точности аннотации, поскольку мы не можем определить «правильную аннотацию» для любого данного белка.

Подробнее …

-Экспериментальные данные на уровне белка и

Это указывает на тип доказательств, подтверждающих существование белка. Обратите внимание, что свидетельство «существования белка» не дает информации о точности или правильности отображаемых последовательностей.

Подробнее …

Выберите раздел слева для просмотра содержимого.

В этом разделе представлена ​​любая полезная информация о белке, в основном биологическая информация.

Подробнее …

Function i

Участвует в сплайсинге пре-мРНК как компонент сплайсосомы (PubMed: 28781166). Вспомогательный сплайсосомный белок, который регулирует выбор альтернативных сайтов сплайсинга в небольшом наборе видов-мишеней пре-мРНК (вероятно). Требуется для нормального развития митотического клеточного цикла (PubMed: 22351768, PubMed: 24252166).Рекрутирует MAD1L1 и MAD2L1 в кинетохоры и требуется для запуска контрольной точки сборки шпинделя (PubMed: 22351768). Требуется для нормального накопления SMU1 (PubMed: 24945353).

Информация, подобранная вручную, для которой опубликованы экспериментальные данные.

Дополнительно …

Ручное утверждение, основанное на эксперименте в i

  • Процитировано для: ФУНКЦИЯ, ВЗАИМОДЕЙСТВИЕ С MAD1L1, ПОДКЛЕТОЧНОЕ РАСПОЛОЖЕНИЕ, ИНДУКЦИЯ.

  • Процитировано для: ФУНКЦИЯ, ПОДКЛЕТОЧНОЕ РАСПОЛОЖЕНИЕ, ВЗАИМОДЕЙСТВИЕ С DHX15.

  • Указано для: ФУНКЦИЯ (МИКРОБНАЯ ИНФЕКЦИЯ), ВЗАИМОДЕЙСТВИЕ С SMU1, ВЗАИМОДЕЙСТВИЕ (МИКРОБНАЯ ИНФЕКЦИЯ) С СУБЪЕКТАМИ РНК-ПОЛИМЕРАЗЫ ВИРУСА А ВИРУСА PB1 И PB2, ПОДКЛЕТОЧНОЕ РАСПОЛОЖЕНИЕ.

  • Указано для: СТРУКТУРА С ПОМОЩЬЮ ЭЛЕКТРОННОЙ МИКРОСКОПИИ (4,50 АНГСТРОМА), ФУНКЦИЯ, ПОДБЛОК, ПОДКЛЕТОЧНОЕ РАСПОЛОЖЕНИЕ, ИДЕНТИФИКАЦИЯ ПО МАСС-СПЕКТРОМЕТРИИ.

(микробная инфекция) Требуется вместе с SMU1 для нормального сплайсинга пре-мРНК NS1 вируса гриппа A, который необходим для продукции экспортина NS2 и для продукции частиц вируса гриппа А. Не требуется для pro

.

Добавить комментарий

Ваш адрес email не будет опубликован.