Перечень продуктов содержащих белок: список из 48 продуктов с повышенным содержанием протеина

Белковая пища, список высокобелковых продуктов, еда с высоким содержанием белка

Белки — строительный материал для мышц человека, поэтому при похудении или наборе мышечной массы рекомендуется к употреблению больше белковой продукции. Белковая пища — это польза не только для похудения или иного изменения своего веса, но и для работы внутренних органов. Так, дефицит белка приводит к снижению содержания в крови кальция и гемоглобина, отчего страдают внутренние органы, зубы и волосы, беременным женщинам приходится сталкиваться с проблемами в развитии плода. Все объясняется нехваткой кислорода. Но и чрезмерное употребление белковых продуктов опасно для здоровья человека. О чем следует помнить при формировании своего рациона.

Содержание статьи

Содержание

О действии на организм

Белковые продукты должны входить в рацион человека в определенном и разрешенном для здоровья количестве. Суточная норма белка составляет 1-1,5 г на 1 килограмм веса человека. Поэтому чтобы не навредить своему организму, требуется внимательно относиться к выбору белковых продуктов и их количеству для употребления с целью похудения или набора мышечной массы. Важно включать белковые продукты в рацион питания, поскольку эти вещества оказывают положительное действие на организм человека.

Положительные моменты употребления белковых продуктов заключаются в следующих особенностях:

  • они способствуют выведению из организма шлаков и токсинов;
  • происходит укрепление сердца и сосудов вследствие снижения общего уровня сахара в крови;
  • обеспечивается рост мышечной массы, поскольку происходит нормализация выработки инсулина — он сжигает глюкозу, преобразуя ее в энергию, формирующую мышечные клетки;
  • белковые продукты помогают выведению лишней жидкости из жировых клеток, при этом способствуют нормализации водного баланса;
  • они сохраняют мышечные клетки, подвергая сжиганию только жировые;
  • белковая пища помогает похудению вследствие улучшения метаболизма;
  • они помогают снизить чувство голода, поэтому человек во время похудения начинает меньше страдать от сниженных по объему порций.

Белковые продукты помогают похудению, поэтому нередко спортсмены стремятся к практике, называемой сушкой тела. Это та самая диета, которая помогает сохранить мышечную массу, но по максимуму уничтожить жировые клетки.

Примечательно, что выход из диеты на продуктах, содержащих большое количество белка, происходит с меньшими для людей потерями. Во-первых, лишний вес не возвращается. Во-вторых, человек не чувствует осложнений.

ВидеоВидео

Виды белков

Белковая еда подразделяется на два вида — животного происхождения и растительного. Для эффективного похудения и поддержания здоровья 70% белков в рационе человека должны быть именно животного происхождения, а остальные 30% — растительного. Эти пропорции не обязательны к соблюдению в точности до грамма, но рекомендованы для поддержания нормального состояния организма.

Видео

Каждый из видов белков имеет свои преимущества и недостатки, поэтому при формировании своего рациона для похудения или поддержания веса следует учитывать все особенности разновидностей.

Животные

Вещества животного происхождения усваиваются быстро, но в них содержится много жиров, поэтому при похудении можно снижать рекомендованное количество на 20%. Но диетологи советуют попросту заменять жирные виды мяса нежирными. К примеру, для употребления рекомендуются курица, индейка, телятина, кролик и прочие разновидности высокобелковых продуктов со сниженной калорийностью. Запрещено включать в рацион свинину и баранину. Также белковые продукты животного происхождения включают в себя кисломолочную продукцию. Это молоко, кефир, сметана и творог. Если включать представленные продукты в рацион во время похудения, рекомендуются разновидности только со сниженной калорийностью, а также обезжиренные виды творога, кефира.

ВидеоВидео

Растительные

Вещества растительного происхождения усваиваются организмом гораздо медленнее, но их можно употреблять в больших количествах вследствие отсутствия в них жиров. Чтобы в точности понять, что такое белки растительного происхождения или животного, представлена таблица белковых продуктов, которые помогут самостоятельно составить свой рацион для эффективного и безопасного похудения.

Списки продуктов

Далее необходимо подробнее ознакомиться с особенностями белковых продуктов, а также изучить сам список продуктов, который рекомендован для составления рациона с целью похудения. Это необходимо также для правильного соотношения не только белков в рационе, но и «взаимодействия» углеводов и жиров.

Обратите внимание: Рекомендуется учитывать калорийность продуктов, поскольку суточная норма калорий для человека не должна быть превышена. В противном случае похудения на белках не произойдет ни при каких обстоятельствах.

Список белковых продуктов представляется подробно в таблицах. В данном случае представляются три группы продуктов, которые рекомендуется включать в рацион для похудения и сохранения мышечной формы.

Мясо, яйца и субпродукты

Видео

ВидеоВидео

Рыба и морепродукты

Видео

Молоко и кисломолочные продукты

Из представленных выше таблиц становится понятным, что многие продукты содержат огромное количество калорий, отчего их употребление не становится безопасным при снижении веса, несмотря на большое количество вещества.

Видео

В результате диетологи помогают людям, желающим сбросить лишний вес, составив более подробные таблицы продуктов с содержанием углеводов и жиров. Это поможет составить свой рацион в соответствии с рекомендуемой суточной калорийностью для человека, а также сохранить хорошее самочувствие.

ВидеоВидео

Примечательно, что для похудения рекомендуется использовать продукты со сниженным содержанием жира. Но белковые продукты с большим количеством жира в составе можно вводить в рацион в период выхода из диеты.

Видео

Наилучшие продукты

Диетологи составили свой список полезных продуктов, рекомендуемых для употребления во время похудения. Их вводят в рацион в соответствии с особенностями и влиянием на организм — учитывают аллергическую предрасположенность или индивидуальную непереносимость. Некоторые из них могут вызвать газообразование, поэтому в употреблении лучше ограничиться.

Яйца

Яичный белок входит в состав большинства протеиновых составов, которые употребляют спортсмены с целью нарастить мышечную массу за короткое время. Это и понятно, поскольку яйцо содержит огромное количество полезных веществ, при этом в нем мало калорий и практически нет жира.

ВидеоВидео

Для похудения в день разрешается съедать всего 7 яичных белков и 4 желтка. Существуют специальные диеты, предполагающие употребление только на завтрак 5 яиц в течение недели.

Это важно: Специалисты разрешают в неделю употреблять не больше 3-4 яичных желтков, поскольку этот продукт отрицательно сказывается на состоянии печени. Поэтому увлекаться поеданием яиц не следует, лучше заменить их другими низкокалорийными и белковыми продуктами.

Кефир со сниженной жирностью или натуральный йогурт

Этот продукт лежит в основе большинства диет, поскольку здесь содержание белка составляет 28 г на 100 г кефира, что обеспечивает полноценность употребленных веществ. Кисломолочный продукт избавляет от шлаков и токсинов, отчего лишний вес уходит быстрее. Йогурт выбирается без подсластителей и фруктовых добавок.

Творог

Белки творога быстро усваиваются, отчего человек не чувствует тяжести, но при этом в течение длительного времени не хочет есть. В 100 г продукта не менее 20 г рассматриваемого вещества. При этом эта белковая пища помогает улучшить состояние ногтей, волос, зубов и костей.

Молоко

Эта белковая пища входит в список продуктов и занимает лидирующие позиции по содержанию белка и полезных микроэлементов, обогнав мясо и рыбу. Все заключается в легкой усвояемости и положительном воздействии на работу желудка.

Мясо

Мясо содержит до 20 г вещества на 100 г продукта и всего 2 г жира, если говорить о нежирных разновидностях. Рекомендуется выбирать говядину, курицу и прочие нежирные виды мяса, чтобы сбросить вес в короткое время.

ВидеоВидео

Рыба

Рекомендуется вводить в рацион филе лосося, в котором содержится много жиров омега-3. В результате эта рыба помогает справиться с нервными расстройствами, а также снизить лишний вес. Разрешается употреблять только тушеную или отварную рыбу, слабосоленая под запретом.

Бобовые культуры

Это белки растительного происхождения, которые рекомендуется употреблять в небольших количествах во избежание вздутия живота или запора. Бобовые культуры имеют в составе полезные пищевые волокна, которые дают длительное чувство насыщения, а также поддерживают мышечную массу при экстремальном похудении.

Протеиновые коктейли и порошки

От протеиновых коктейлей отказываться не следует, в особенности при желании быстрого похудения с минимальным употреблением калорий. При правильном подходе к преображению своего тела именно коктейли помогают улучшить рельеф — при обязательном посещении спортивного зала.

ВидеоВидео

Рецепты для приготовления блюд

Чтобы не возникли вопросы по поводу разнообразия в питании, предлагается несколько рецептов для приготовления блюд:

  • Суп из шпината. Сварить куриную грудку индейки без кожицы, вынуть ее из кастрюли. В полученный бульон всыпать упаковку замороженного шпината, предварительно мелко порезанного. Варить в течение 10 минут. Индейку порезать и забросить обратно, проварить еще 10 минут, измельчить блендером. Добавить ¼ стакана молока и 2 зубчика измельченного чеснока.
  • Белковый суп с фрикадельками. Сварить кусок курицы с костями. Вынуть ее, отделить мякоть и приготовить из куриного фарша фрикадельки. В бульон опустить полученные куриные фрикадельки и овощи по вкусу (исключаются корнеплоды). Лучше отдать предпочтение зеленым овощам — перцу, стручковой фасоли и прочему.
  • Курица в кефире. Куриное филе посолить, поперчить и залить кефиром. Оставить в холодильнике для маринования в течение 3 часов. Тушить на горячей сковороде по 10 минут с каждой стороны.
  • Запеченная рыба. Взять филе лосося, сдобрить лимонным соком, посолить, поперчить, посыпать травами и специями. Запекать в духовке на фольге без масла до готовности.
  • Белковый салат. 3 сваренных всмятку яйца измельчить, накрошить отварную куриную грудку в количестве 150 г, нашинковать 50 г отварных кальмаров. Заправить все солью, приправами по вкусу, сметаной или натуральным йогуртом.
  • Белковый салат из спаржи с курицей. Смешать 100 г нашинкованной спаржи, 3-4 соцветия сваренной цветной капусты и 300 г куриной грудки. Добавить 2 свежих огурца и 60 г корня сельдерея, 2 столовые ложки горошка консервированного. Заправить яблочным уксусом по вкусу, посолить и сдобрить специями.

Можно придумывать блюда самостоятельно. В этом деле главное условие — это максимально ответственно подойти к подсчету количества белков и белковой пищи в целом.

ВидеоВидео

Советы для употребления белковых продуктов

С целью похудения рекомендуется прибегнуть к соблюдению следующих основных советов, касающихся употребления белковых продуктов:

  • Мясо и рыбу лучше есть в отварном виде, тушеном или запеченном. Можно готовить на пару.
  • Во время снижения веса организм не должен страдать от неправильного функционирования внутренних органов. Так, в рацион в обязательном порядке должны входить фрукты и овощи, кисломолочные продукты, крупы и цельнозерновой хлеб, много зелени.
  • За час до сна разрешается выпить стакан кефира, лучше обезжиренного. Или заменить кефир стаканом натурального йогурта.
  • Различные добавки — сладкие йогурты, соусы, а также заменители белка — не рекомендуются к использованию при похудении.
  • За один прием пищи допускается употребление 30 г белка. Это безопасное похудение с сохранением работы внутренних систем.
  • Пища должна употребляться дробно — не менее 6 раз в день. Можно увеличить до 8 раз, если день бодрствования достаточно долгий. Но важно учитывать, что ужинают не позднее 19:00.
  • Белковое питание вместе со спортивными нагрузками помогут в улучшении внешнего вида — заметно укрепляются мышцы ног, бедер, уменьшается талия, подтягивается грудь у девушек.

Белковое питание не всегда творит чудеса. Оно опасно для людей с наличием хронических заболеваний внутренних органов.

Видео

Чтобы избежать обострений, следует отказаться от белковой диеты и отдать предпочтение правильному питанию с соблюдением рекомендаций по употреблению белков, жиров и углеводов. Для похудения к белковой диете прибегают не чаще 1 раза в год, в крайнем случае — 1 раз в полгода.

Белковые продукты для похудения: список с таблицей

Опубликовано: 04.10.2019Время на чтение: 6 минут5996

Роль белковых продуктов в похудении

Когда белок называют строительным материалом для клеток организма, часто упускают из виду то, что это вещество является незаменимым участником метаболизма. При его участии невозможны катаболизм (расщепление различных сложных веществ на более простые и легкие для усвоения) и анаболизм (создание новых соединений из нескольких других). В совокупности это позволяет поддерживать все функции организма на нужном уровне, обеспечивать телу необходимый уровень энергии, теплообмен и пр. Но во время похудения гораздо важнее другое: именно активный и качественный метаболизм – залог активного расщепления и утилизации жировых клеток, которые формируют подкожные запасы. Кроме того, белок требует достаточно много энергии для расщепления на составляющие его аминокислоты, что также добавляет эффективности похудению.

Интересный факт: В руководстве по спортивному питанию NSCA для набора сухой мышечной массы рекомендуется потреблять 1,3-2 г/ кг массы тела в день.

Чем опасен переизбыток белковых продуктов в рационе

Безусловно, продукты с высоким содержанием белка для похудения незаменимы. Но нельзя делать ставку только на протеины, которые выстроят вам красивое тело и сохранят здоровье. Без достаточного количества жиров расщепление подкожной жировой клетчатки замедляется, а без углеводов уровень энергии снижается настолько, что прогресс в потере лишнего веса вряд ли обрадует. При переизбытке белка в рационе здоровье страдает еще больше. Ненужный протеин – который не пойдет на строение клеток и их восстановление и не примет участие в обмене веществ – выводится из организма через почки. Соответственно, чем больше белков в рационе, тем выше нагрузка на эти органы. И если почки справляются недостаточно хорошо, или протеинов больше, чем они способны переработать, то возникает состояние, которое можно назвать белковой интоксикацией – отравлением организма продуктами распада белка.

Суточная норма

Наиболее активно белки расходуются после физических нагрузок (для восстановления мышечных клеток), в результате перенесенной болезни, после длительных диет с выраженным дефицитом калорий и монодиет. В таких случаях рекомендуется потребление протеина из расчета 1-1,5 г на 1 кг массы тела. Но если образ жизни далек от активного, и мышцы чаще отдыхают, чем работают, – количество белка рекомендовано снизить до 0,75 г на 1 кг массы тела. Конечно, периодическое превышение или снижение доли протеинов в рационе не нанесет ущерба здоровью и даже вряд ли станет ощутимым. Но долгосрочные эксперименты с этим веществом (чрезмерное его количество или выраженный недостаток) негативно отразятся на самочувствии, внешности и даже прогрессе похудения: в попытке справиться с белковой интоксикацией или отсутствием строительного материала для клеток организм снижает потребление энергии и переходит в режим ее сбережения. Как результат, подкожный жир перестает участвовать в энергетическом обмене, а слабость и повышенная утомляемость не позволяют вернуться к тренировкам или проводить их на достаточно активном уровне, чтобы разогнать обмен веществ до нормального. Но следить за количеством белка в рационе недостаточно. Желательно организовать питание так, чтобы в меню были все виды белков.

Виды белков в рационе человека

Белки можно разделить на две крупные группы: животного и растительного происхождения. Они принадлежат к одному классу химических соединений и в целом выполняют одни и те же функции, но при этом имеют несколько различий.

Животные белки. Их преимущество заключается в составе аминокислот – цепочек, из которых строится молекула протеина. Продукты животного происхождения относятся к полным белкам: в их состав входят все незаменимые аминокислоты – соединения, которые организм неспособен вырабатывать самостоятельно, но без них он не может нормально функционировать. Условный недостаток продуктов животного происхождения – большое количество жиров, которое может свести к нулю все усилия по похудению.


Растительные белки. Состав таких протеинов более скудный, так как только соя и киноа содержат в себе незаменимые аминокислоты. Все остальные растительные продукты лишены одной-двух аминокислот этой группы, что делает их менее предпочтительными в рационе человека. Но это лишь на первый взгляд: при полноценном и разнообразном питании этот недостаток растительного белка легко устраняется. Сочетание разных белков растительного происхождения может давать в сумме весь комплекс аминокислот: и заменимых, и незаменимых. Какие продукты выбирать – дело личного вкуса и предпочтений. Но похудение – процесс, требующий достаточного количества энергии и сил, поэтому важно учесть еще один нюанс. Растительные белки расщепляются дольше и требуют от организма больше ресурсов, чем протеины животного происхождения.


Продукты, содержащие наибольшее количество белка

Если распределить по количеству протеина все продукты для похудения, богатые белком, список будет выглядеть следующим образом:

  • Соя – 36 г белка/ 100 г продукта.
  • Мясо гуся – 29 г /100 г.
  • Тунец – 29 г/100 г.
  • Твердый сыр – 23-29 г /100 г.
  • Икра кеты – 27 г/100 г.
  • Семга – 25,5 г/100 г.
  • Курица – 25 г/100 г.
  • Свинина – 25 г/100 г.
  • Баранина, индейка, кролик – 24 г/100 г.
  • Говядина – 23 г/100 г.
  • Миндаль, черные бобы – 21 г/100 г.
  • Печень – 18-19 г/100 г.
  • Нут – 19 г/100 г.
  • Куриное яйцо – 13 г /1 шт.
  • Цельное молоко – 3 г/ 100 г.

Низкокалорийные продукты с содержанием белка

Для похудения продукты, богатые белком, лучше выбирать из списка низкокалорийных и легкоусвояемых. В этом случае организм не будет обременен ненужными задачами, такими как расщепление и усвоение слишком «тяжелых» протеиновых продуктов и блюд, и снижение массы тела будет протекать рационально: за счет жировых отложений, а не энергетических ресурсов организма. Поэтому следует учитывать содержание жиров в том или ином продукте и его калорийность. В представленном выше списке продукты поменяют свои позиции, если распределить их по калорийности (содержанию Ккал) в 100 г.

  • Бобы – 58.
  • Цельное молоко (в зависимости от жирности) – 31-58.
  • Яйцо – 70.
  • Тунец – 96.
  • Печень – 98-114.
  • Семга – 142.
  • Курица (без кожи) – 150.
  • Баранина (нежирная) – 160.
  • Индейка – 165.
  • Кролик – 181.
  • Говядина – 220-270.
  • Свинина (в зависимости от жирности) – 220-330.
  • Икра кеты – 260 Ккал.
  • Твердый сыр (в зависимости от сорта) – 280-410.
  • Мясо гуся – 319.
  • Нут – 364.
  • Соя – 380.
  • Миндаль – 645.

Белковая пища в списке продуктов для похудения предоставляет огромные возможности для выбора и простор для фантазии: диета для снижения массы тела больше не выглядит мучительным процессом, требующим героических волевых усилий. Белковые продукты можно включать в самые разные рецепты и готовить из них все, что нравится и что полезно, – от супов и вторых блюд до праздничных салатов и изысканных десертов. И понятие «диетично» больше не ассоциируется с «пресно» и «безвкусно». Если хочется разнообразить рацион и гарантированно избежать набора лишнего веса, можно обратиться к продукции Herbalife. Высокое содержание белка в протеиновых коктейлях обеспечит долгое ощущение сытости и поможет в похудении. Кроме того, такие смеси имеют и другие преимущества:

  • содержат 30 % от суточной нормы антиоксидантов;
  • в составе – 23 важнейших микроэлемента, необходимых для нормальной работы организма;
  • 10 вкусов помогут разнообразить рацион.

А от переедания на ночь защитит специальная формула «Вечернего коктейля». Отличная замена высококалорийному ужину, которая и насытит, и обеспечит организм токоферолом, необходимым для спокойного сна, и поможет плавно снижать вес. 

Что помогает и мешает усвоению белка

Белок не расщепляется и не усваивается сам по себе: попадая в организм вместе с пищей, он становится участником сложнейшей цепи биохимических реакций, которые приводят протеин в состояние, при котором он становится полезен клеткам тела. Поэтому просто потребления белка недостаточно: важно следить за тем, чтобы сохранялся баланс других веществ, необходимых для белкового обмена. Наиболее важными из них являются витамин C и витамины группы B, которые присутствуют в больших количествах в зелени и листовых овощах, овсянке, грецких орехах, томатах, субпродуктах, киви, шиповнике, цитрусовых. Разнообразив свой рацион этими продуктами, можно быть уверенными: белок не просто поступает в организм, но и полноценно усваивается.


Узнайте, как питаться
сбалансированно
и контролировать
свой весУзнать больше 2019-10-04

Автор: Будь в Форме

Оцените материал!

Добавить отзыв


Отзывы

Екатерина | 25.05.2020 13:57
Оценка 5

Спасибо за полезную статью, оставляю ее в закладочках, как раз собираюсь садится на белковую диету

Продукты, содержащие белок: таблица

Белок, как известно, является важнейшим строительным материалом для нашего организма. Без него невозможна регенерация тканей, набор мышечной массы и даже эффективное похудение. В последнее время особой популярностью стали пользоваться пищевые добавки — протеиновые коктейли. А, между тем, мы забываем, что пополнять запасы белка в организме можно с помощью продуктов питания.

Какую роль играют белки в организме

Белок, протеин и полипептиды – это один и тот же элемент, имеющий одну химическую формулу. Основа молекулы белка — цепочка из аминокислот, без которых организм просто не может жить. Белки содержатся в каждой клетке и участвуют во всех обменных процессах. Кроме того, белки служат незаменимым источником сил. После употребления белковой пищи мы чувствуем прилив энергии и сил, а также сытость на протяжении нескольких часов. Без белков печень превращает протеины в жир, формируя запас быстродоступного источника энергии.

Молекула белка отображается химической формулой: h3N–CH(R)–COOH

Белки в организме человека — это основной материал для развития и роста всех без исключения клеток. Аминокислоты, содержащиеся в белке, ничем не заменимы, но все же, самой важной их функцией является участие в репликации молекул ДНК и РНК. Также без аминокислот невозможно образование многих гормонов, производство гемоглобина и ферментов, построения новых клеток и восстановления поврежденных. Вся жизнедеятельность нашего организма построена на белково-углеводных процессах. Кроме того, белковая пища незаменима при восстановлении организма после долгой болезни.

Белок относится к тем веществам, которые не накапливаются и не производятся нашим организмом — его необходимо получать извне. Самым доступным способом являются продукты с содержанием протеинов (белка).

Однако, бывают ситуации и заболевания, когда нужно ограничивать употребление белков. К таким относят почечную недостаточность, при которой количество белка не должно превышать 20-40 г в сутки.

Регулярное употребление белковой пищи гарантирует регенерацию всех тканей и быстрое наращивание мышечной массы (заметьте — именно мышечной, а не жировой). Протеины могут содержаться как в продуктах животного происхождения, так и в растительной пище. Но при необходимости набора мышечной массы спортсменами приходится пить протеиновые коктейли, так как белковых продуктов для этого не хватает.

Для чего нужны протеины спортсменам? Во время спортивных тренировок тратится достаточно много энергии, которую нужно восстанавливать. Кроме того, при занятиях определенными видами спорта нужно употреблять нужное количество протеинов. Так, доза белка при занятиях бодибилдингом составляет 2-3 г на 1 кг веса спортсмена.

Также протеиновые коктейли используют и для похудения. Как можно похудеть с помощью протеинов?

Как похудеть с помощью протеинов

Дело в том, что без достаточного количество белка и физической активности, наш организм мышечную ткать превращает в жировую. А вот похудеть потом оказывается сложнее. Поэтому, чтобы похудение проходило быстрее и легче, нужно обеспечить организм достаточным количеством белковой пищи, а не сидеть на долгих изнуряющих диетах.

Однако, нужно сочетать продукты, содержащие белок, и протеиновые добавки с физическими нагрузками. Чем больше мышечной массы — тем легче организму худеть. К тому же, с помощью белков и спорта можно получить аппетитные рельефные формы тела.

Дополнительный прием аминокислот позволяет сжигать только жировую ткань, наращивая при этом мышечную. А значит, вместе с приемом протеиновых коктейлей придется и попотеть в спортзале.

Чтобы обеспечить усваиваемость протеина, рацион должен содержать и углеводы

Чтобы похудеть с помощью протеинов, нужно соблюдать следующие рекомендации по питанию: свести к минимуму вредных углеводов, а калорий потреблять на 15% меньше, чем тратится за день.

Продукты, богатые протеинами

Чтобы знать, какими продуктами можно заменить протеиновый коктейль, нужно запомнить продукты, богатые белком — таблица в этом поможет. Мы употребляем белковые продукты ежедневно, даже не задумываясь об этом. Но существует список продуктов, в которых содержание протеинов самое высокое. В совокупности с углеводами белки из этих продуктов легко усваиваются и надолго вызывают чувство сытости.

Итак, таблица продуктов, содержащих белок.

Молочные и кисло-молочные продукты. Являются чемпионом по содержанию белка. Кроме того, молоко и его производные известны как самый главный источник кальция, способствующий укреплению костной ткани. Содержание белка в молочных продуктах таблица:

Продукт Содержание белка в 100 г
Молоко 2,8 г
Молоко сухое цельное 25,6 г
Йогурт натуральный (1,5% жирности) 5 г
Кефир нежирный 3 г
Творог нежирный 18 г
Брынза из коровьего молока 17,9 г
Сыр голландский 26,8 г
Сыр пошехонский 26 г

Яичные белки. Содержание белка на 100 г продукта составляет 3,6 г.

Рыба и морепродукты. Креветки, лосось, треска, окунь, палтус — любая рыба является известнейшим источником легкоусваиваемого белка. К тому же, только в рыбе содержатся незаменимые омега-кислоты, влияющие на нашу красоту и молодость. А йод помогает работу головного мозга и улучшает память, что актуально для школьников. Разная рыба содержит разное количество белка:

Продукт Содержание белка в 100 г
Креветка дальневосточная 28,7 г
Тунец 22,7 г
Кета 22 г
Горбуша 21 г
Семга 20,8 г
Сайра 20,4 г
Палтус 18,9 г
Кальмар 18 г
Сельдь 17,7 г
Скумбрия 18 г
Минтай 15,9 г
Икра осетровая зернистая 28,9 г

Мясо: курица, говядина, индейка, телятина. Что касается мяса, то оно также является известнейшим источником белка, причем более бюджетным, чем некоторые сорта рыбы. Но не только мякоть мяса содержит белок, его также много в субпродуктах, например. в печени. Содержание белка в мясе таблица:

Продукт Содержание белка в 100 г
Говьяжья печень 18,4 г
Баранья печень 18,7 г
Свиная печень 18,8 г
Индейка 21,6 г
Сердце 15 г
Кирица 20,8 г
Цыплята 18,7 г
Кролик 20,7 г
Говядина 18,9 г
Свинина нежирная 18,4 г
Свинина жирная 11 г
Телятина 19,7 г

Соя. Содержание растительного белка в сое составляет 34,9 г на 100 г продукта, в соевом мясе белков еще больше — 54 г на 100 г продукта (при этом содержание жира всего 1 г). Кроме того, что соя — чемпион среди белковых растительных продуктов, она оказывает также другое положительное влияние на наш организм: нормализует уровень сахара в крови, ускоряет обмен веществ, очищает желчные протоки, защищает от образования раковых клеток, замедляет процессы старения.
Орехи, семена и бобовые. В этих продуктах содержится достаточное количество растительного белка, а также витаминов и других микроэлементов. Итак, растительные продукты содержащие белок в количестве таблица:

Продукт Содержание белка в 100 г
Арахис 26,3 г
Семена подсолнечника 20,7 г
Миндаль 18,6 г
Фундук 16,1 г
Грецкий орех 13,8 г
Горох 20,3 г
Нут 20,1 г
Красная чечевица 24,2
Красная фасоль 22,3 г
Белая фасоль 25,1 г

Хлеб и крупы. Так как в основе хлебо-булочных изделий лежит мука, яйца и дрожжи, то, конечно же, в готовых изделиях также содержится белок. Однако, его все же меньше, чем в мясе и рыбе. Ну и, конечно, не обделила природа белком и крупы.

Продукт Содержание белка в 100 г
Хлеб ржаной 4,7 г
Хлеб из пшеничной муки 1 сорта 7,7 г
Выпечка сдобная 7,6 г
Гречневая ядрица 12,6 г
Грецкий орех 13,8 г
Пшено 12 г
Рис 7 г
Овсянка 11,9
Крупа манная 11,3 г
Крупа перловая 9,3 г
Пшеница цельная 9 г

А что насчет овощей? Содержится ли белок в овощах или фруктах?

Многие уверенны, что в растительной пище, кроме бобовых, белка нет и в помине. Но есть такие продукты, у которых белка гораздо больше, чем в хлебе. В каких фруктах и овощах содержится протеин:

Продукт Содержание белка в 100 г
Дыня 11 г
Клубника 7,5 г
Арбузы 6,1 г
Бананы 5,1 г
Оливки 5,2 г
Чеснок 6,5 г

Итак, мы разобрали, в каких продуктах содержится белок. Таблица содержания белка поможет выбрать наиболее протеиносодержащие продукты для правильного питания.

Продукты, содержащие белок – таблица (список)

31 продукт с высоким содержанием белка. Эти богатые белками продукты необходимы для наращивания мышц и укрепления сил при восстановлении. Белок в медицине всегда был популярен. Причиной этой популярности является жизненно важная роль белка в наращивании мышц.

Когда вы работаете, образуются небольшие капли молочной кислоты в мышцах, поэтому вам нужен белок, который состоит из аминокислот , также известных как строительные блоки мышц, для восстановления этой потери и восстановления мышц, чтобы они стали больше и сильнее.

Зачем нужен белок

Даже если вы регулярно не тренируетесь, белок является жизненно важным питательным веществом для создания и поддержания тканей тела. Ведущие специалисты рекомендует, чтобы мужчины употребляли 55,5 г белка в день. Если вы очень активны, вы захотите значительно увеличить это, даже если сосредоточиться на спортивных соревнованиях выносливости, а не на силовых тренировках. Выносливые спортсмены должны предусмотреть, чтобы каждый день есть 1,2-1,4 г белка на килограмм массы тела, а спортсмены-тяжеловесы должны стремиться к получению1,2-1,7 г на кг веса тела в день.

Прежде чем обращаться к добавкам или обогащенной белками пищевым продуктам для удовлетворения своей квоты на белок, просмотрите наш список продуктов с высоким содержанием белка — есть хороший шанс, что вы сможете получить больше, чем требуется белка, через свой рацион. Мы начали с полного списка, оцененного их содержанием белка на 100 г, а затем разбили список на группы продуктов — мясо, морепродукты, заменители мяса, яйца и молочные продукты, а также орехи, семена и бобовые. Употребляйте эти продукты.

Признаки дефицита белка

Первое время человек не придает никакого значения снижению работоспособности, сильной усталости, упадку сил. Со временем состояние дефицита прогрессирует и появляются такие симптомы:

— Общая слабость затрудняет выполнение повседневных обязанностей, возникают дрожание мышц, вялость, работоспособность резко снижается, возможно нарушение координации движений.
— Бессонница, головные боли, причиной которых являются отсутствие достаточного количества серотонина и других гормонов, малокровие, снижение сахара в крови.
— Изменение характера человека ввиду нехватки ферментов и гормонов. Плохой характер выражается раздражительностью, плаксивостью, агрессивностью, обидчивостью, тревожностью, которых раньше не было.
— Потеря массы тела: на фоне дефицита белка мышцы теряют объем и массу, нарушается обмен веществ, жировые отложения истощаются.
— Нарушения работы дыхательной и сердечно-сосудистой системы: боли в сердце, учащенный пульс, аритмия сердца, одышка, кашель и др.

Последствия чрезмерного потребления белков

1. Болезненное ощущение в нижней части спины из-за нарушения работы почек.
2. Частое мочеиспускание, чрезмерная потливость.
3. Нарушения работы печени, снижение аппетита
4. Головокружение, нарушения работы органов пищеварительной системы.

31 высокопротеиновых продуктов, содержащих белок в 100 г

31 высокопротеиновых продуктов, содержащих белок в 100 г

  1. Говядина вяленая — 30-40 г
  2. Пармезан — 32 г
  3. Стейк тунца — 32г
  4. Индейка — 30г
  5. Арахис 25 — 28 г
  6. Сыр Эдам — 27г
  7. Консервированный тунец — 25г
  8. Сыр Чеддер — 25 г
  9. Говядина — 20-24 г
  10. Цыпленок — 24г
  11. Лосось — 24г
  12. Миндаль — 21г
  13. Сардины 21г
  14. Треска — 20 г
  15. Жаркое из барашка – 20 г
  16. Скумбрия — 20г
  17. Темпех (ферментированный соевый продукт) – 20 г
  18. Орехи кешью — 18 г
  19. Мидии — 18 г
  20. Семена чиа (шалфея испанского) — 17 г
  21. Рубленный бифштекс — 14,5 г
  22. Бразильские орехи — 14г
  23. Фасоль Edamame (соевые бобы) – 13 г
  24. Яйца — 13г
  25. Тофу (соевый творог) — 12г
  26. Творог — 10 г
  27. Греческий йогурт — 10 г
  28. Чечевица — 7-9 г
  29. Фасоль – 8 г
  30. Нут – 7 г
  31. Горох — 6 г

Характеристика продуктов, содержащих белок

Мясо (Вяленая говядина)

Мясо (Вяленая говядина)

Содержание белка: 30-40 г

Храните некоторые из этих высушенных, измельченных кусочков постной говядины в сумке для мясных продуктов, чтобы не подвергать термической обработке в гриле. Различные сорта мяса имеют разные уровни белка — читайте внимательно этикетку продукта, чтобы содержащиеся ингредиенты не превышали допустимой нормы.

Индейка

Содержание белка: 30 г

Ужин с индейкой должен быть не только на Рождество: праздничная птица содержит больше белка на несколько грамм, чем большинство других мясных блюд, в том числе ее самой большой пернатой соперницы — курицы.

Курица

Курица содержит белок

Содержание белка: 24 г

Классический обедненный белковый источник. Цыпленок содержит огромное количество белка, будучи очень низким в содержании жира, особенно если вы предварительно уберете кожу.

Говядина

Содержание белка: 20-24 г

Различные сорта мяса имеют разные уровни белка, но вы можете полагаться на говядину, чтобы получить много мышечного топлива в любых блюдах, которые вы предпочитаете. Выбирайте более компактные куски мяса, чтобы не употреблять слишком много насыщенных жиров.

Ягненок

Содержание белка: 20 г

Те нежные маленькие ягнята, которых вы видите резвящимися в полях каждую весну — они также являются превосходными источниками белка.

Морепродукты

Морепродукты, богатые белком

Стейк из тунца

Содержание белка: 32 г

«Курица моря» — рыба тилапия — богата омега-3 жирными кислотами, среди других ценных питательных веществ, а также белком. Это гораздо более мясистый и вкусный продукт, чем консервированный вариант (см. ниже).

Консервированный тунец

Содержание белка: 25 г

Готовый продукт, укомплектованный тунцом, консервированным в родниковой воде, поможет вам преодолеть все трудности при потере энергии. Он упакован белком и практически не содержит жира.

Лосось

Содержание белка: 24 г

Кроме белка, розовая мякоть лосося содержит множество омега-3 жирных кислот, которые делают его отличным благодаря лечебным свойствам для лечения болезней глаз или снижения риска сердечных заболеваний.

Сардины

Сардины содержат белки

Содержание белка: 21 г

Эта рыба удивительно дешева, если вы покупаете в консервированном виде, она содержит омега-3 жиры, а также прекрасный белок. Сделайте сардины своим новым любимым тостом.

Треска

Содержание белка: 20 г

Эта рыба с низким содержанием жира, но очень вкусная. Естественно, мы советуем избегать некоторых видов трески из-за лишнего жира, который они содержат.

Скумбрия

Содержание белка: 20 г

И филе, и консервированные версии этой масляной рыбы — отличные подборки для быстрого и вкусного белка.

Моллюски

Моллюски богаты белками

Содержание белка: 18 г

Мидии — знаменитый популярный продукт питания в Бельгии.

Заменители мяса

Темпех (ферментированный соевый продукт) Содержание белка: 20 г

Тофу — не единственный продукт сои в кулинарии, и темпех действительно превосходит его более знаменитого кузена с точки зрения его содержания белка и волокна.

Куриный фарш

Содержание белка: 14,5 г

Тофу

Содержание белка: 12 г

Конечно, мы обсуждаем тофу, когда вы поднимаете темп, но это также хороший источник белка. Тофу также гораздо более широко доступен, чем другие продукты.

Яйца и молочные продукты

Сыр Пармезан

Сыр Пармезан содержит белок

Содержание белка: 32 г

Никто не говорит, что может съесть 100 г пармезана за один присест — это умная идея, но если бы вы смогли сделать это, было бы большим потенциалом, получив большую порцию белка.

Сыр Эдам

Содержание белка: 27 г

Сыр Чеддер

Содержание белка: 25 г

Любимый сыр Британии приносит много белка к столу. Это включает в себя версии с низким содержанием жира, если вы пытаетесь снизить потребление насыщенных жиров.

Яйца

Яйца богаты белками

Содержание белка: 13г

Один из лучших способов увеличить потребление белка во время завтрака, несколько средних яиц легко подадут вам более 10 г полезного микроэлемента.

Творог

Содержание белка: 10 г

Вы можете получить версии творога с добавленным белком в наши дни, но даже стандартный материал содержит хорошую порцию. По сравнению с другими сырами он также относительно невелик в жире и соли.

Греческий йогурт

Содержание белка: 10 г

Так же как и белковый, греческий (не греческий стиль) йогурт упакован здоровыми бактериями и ферментами, которые будут творить чудеса для вашего пищеварительного тракта.

Орехи, семена и бобовые

Орехи, семена и бобовые

Арахис

Содержание белка: 25-28 г

Бобовые культуры являются невероятным источником белка, и если вы избегаете жареных и соленых сортов, это довольно здоровая закуска. В форме арахисового масла вы получите около 4 г белка в одной столовой ложке.

Миндаль

Содержание белка: 21 г

Наряду с высоким содержанием белка, миндаль также обладает высоким содержанием клетчатки и еще является отличным источником витамина Е, который необходим для поддержания здоровой кожи и глаз.

Орехи кешью

Содержание белка: 18 г

Любой открытый пакет со смешанными орехами быстро очищается от всех кешью. Это потому, что они самые вкусные из орехов или потому, что они богаты белками? Это, безусловно, вкусно, но они также богаты белками.

Семена чиа

Содержание белка: 17 г

Большинство семян в моде, они наполнены клетчаткой и белком, большая часть жира, содержащегося в них, относится к «хорошему» ненасыщенному разнообразию.

Бразильский орех

Содержание белка: 14 г

Интересный факт: бразильские ореховые деревья могут вырасти до 50 м в высоту и жить до 1000 лет. Они могут быть настолько высокими, что, когда плод созревает и падает сверху, он достигает скорости до 80 км/ч на пути к земле. Все еще думаешь о белке? В орехах содержится белок.

Фасоль Edamame

Фасоль Edamame

Содержание белка: 13г

Эти вкусные бобы можно купить замороженными, чтобы потреблять в удобное для вас время, добавьте в свой рацион клетчатку, витамины и минералы вместе с белком. Если вы обнаружите, что они слегка мягкие, попробуйте оживить их свежим лимонным соком, копченой паприкой и щепоткой соли.

Чечевица

Содержание белка: 7-9 г

Каким бы ни был ваш любимый тип чечевицы, вы можете быть уверены, что добавляете дополнительный белок в ваш рацион. Используйте их, чтобы сдобрить мясистые рагу и приготовить салаты.

Нут

Содержание белка: 7 г

Один из самых ранних культивируемых бобовых культур — начиная с 7500 лет назад на Среднем Востоке — нуты особенно богаты фолатом, витаминами группы B, который помогает поддерживать и укреплять здоровую нервную систему. Смешайте с лимоном, свежим чесноком и пастой тахини из семян кунжута для приготовления легкого и вкусного домашнего хумуса.

Фасоль

Содержание белка: 8 г

120-граммовая порция (половина обычной банки) обеспечивает впечатляющее 7,4 г волокна, которое играет ключевую роль в здоровой пищеварительной функции, а также в 8,3 г белка. Не ограничивайте эти вкусные бобы чили с мясом — они великолепны в карри, рагу и салаты.

Горох

Содержание белка: 6 г

Несколько ложек гороха добавляют в вашу тарелку полезное количество белка.

Заключение

Теперь вы знаете все о продуктах, содержащих белок. Ешьте на здоровье и берегите себя! Чтобы немного расслабиться, предлагаю послушать прекрасную мелодию.

Имена белков

В этом подразделе раздела «Имена и таксономия» представлен исчерпывающий список всех названий белка, от общеупотребительных до устаревших, что позволяет однозначно идентифицировать белок.

Этот подраздел также включает в себя информацию об активности белка, такую ​​как точное описание каталитического механизма ферментов, или информацию об отдельных белковых цепях или функциональных доменах, содержащихся в нем, если это уместно.

UniProtKB / Swiss-Prot «Имена белков» подраздел

Подраздел состоит из 2 категорий и нескольких подкатегорий названий и сокращений белка. Он всегда начинается с «Рекомендованного имени» («RecName» в текстовом файле). Альтернативные имена перечислены под заголовком «Альтернативные имена» («AltName» в текстовом файле).

Номер ферментной комиссии Номер ферментной комиссии
Поле категории Поле подкатегории Количество элементов Описание
Рекомендуемое имя 1 Полное наименование, рекомендованное консорциумом UniProt.
Краткое наименование (я) 0-н Аббревиатура от полного имени или аббревиатуры.
ЕС 0-н .
Альтернативные названия 0-н Синоним рекомендуемого имени (ФИО).
Краткое наименование (я) 0-н Сокращение полного названия или аббревиатуры.
ЕС 0-н .
Альтернативные названия Allergen 0-1 См. Аллергенская номенклатура и список записей.
Альтернативные названия Biotech 0-1 Название используется в биотехнологическом контексте.
Альтернативные названия CD_antigen 0-n См. Номенклатура молекул дифференцировки клеток человека и список записей.
Альтернативные названия ИНН 0-н Международное непатентованное название: общее название для фармацевтической субстанции или активного фармацевтического ингредиента, которая является всемирно признанной общественной собственностью.

Если известно, что белок расщепляется на несколько функциональных компонентов, описание начинается с названия белка-предшественника, за которым следует раздел , расщепленный на … . Каждый компонент описан в отдельном разделе. «Альтернативные имена» разрешены для каждого отдельного компонента.
Пример: P01189 («Разбит на следующие 11 цепочек:»)

Если известно, что белок включает несколько функциональных доменов, каждый из которых описывается своим именем, описание начинается с названия всего белка, за которым следует раздел (ы) « Включая ».Каждый домен описан в отдельном разделе. «Альтернативные имена» разрешены для каждого отдельного домена.
Пример: P27708 (‘Включая следующие 3 домена:’)

UniProtKB / TrEMBL «Имена белков» подраздел

Формат раздела «Имена белков» в UniProtKB / TrEMBL близко соответствует формату, используемому в UniProtKB / Swiss-Prot. Однако, поскольку UniProtKB / TrEMBL не аннотируется вручную, описание импортируется непосредственно из базовой записи нуклеотида, и его точность зависит от информации, предоставленной отправителем записи нуклеотида.Вот почему записи UniProtKB / TrEMBL обычно имеют « Отправленное имя » («SubName» в текстовом файле) вместо «Рекомендуемое имя». Может быть более одного «отправленного имени». «Переданные имена» могут позже быть улучшены с помощью автоматических процедур аннотирования (метка затем изменится с «SubName» на «RecName»), но если нет, то она останется такой, как предоставлена ​​отправителем, пока запись не будет аннотирована вручную и не интегрирована в UniProtKB / Swiss-Prot.

Сопутствующие документы
,
баз данных белок-белковых взаимодействий — OpenWetWare
  • GPS-Prot позволяет легко запрашивать и отображать ИЦП человека, агрегированные из всех основных баз данных
  • Включает в себя BioGrid, DIP, IntACT, HPRD, MINT, BIND, MIPS и многое другое
  • Каждое взаимодействие сопровождается ссылкой на публикации в хронологическом порядке на PubMed. Доступ ко всей истории публикации для любого взаимодействия.
  • Экспериментальные методы, куратор из литературы, перечислены для каждого взаимодействия (например,грамм. Аффинная хроматография, рентгеновская кристаллография).
Мнение

: простота использования и полнота, позволяет любому, от студентов до экспертов, легко просматривать сеть PPI

  • Интуитивно понятный поиск Wiki-Pi позволяет эффективно находить и обнаруживать взаимодействия
  • Взаимодействие
  • обеспечивается автоматически обновляемыми аннотациями отдельных белков из баз данных, таких как Gene Ontology, KEGG, REACTOM, Pubmed2ENSEMBL и DrugBank
  • поиск взаимодействия с простыми запросами, такими как ассоциации с заболеваниями или путями, или сложными запросами, обусловленными аннотациями одного или обоих белков во взаимодействии
  • последние ссылки: [1]

Мнение: отличные результаты поиска, хорошее табличное представление.

  • собирает данные из геномного контекста, высокопроизводительных экспериментов, консервативного совместного выражения и анализа текста
  • , созданный CPR, EMBL, SIB, KU, TUD и UZH
  • последние ссылки: [2], [3]

Мнение: простота в использовании, отличная графическая карта взаимодействия, подробное объяснение доказательств

Мнение: по умолчанию используется таблица результатов с завышенными размерами (> 2 ширины экрана на 13 «). Используйте» Изменить предварительные настройки таблицы «, чтобы сжать. Отдельные столбцы для ссылок / псевдонимов / pubID могут быть объединены или наведены для упрощения таблицы по умолчанию. на глаз.В целом представление результатов, по-видимому, в большей степени ориентировано на биоинформатиков, чем на пользователей с таблицей, полной кодов, а не имен (знаете, что такое 9606?). Кроме того, нет простого выбора видов и, что более важно, нет графического обзора.

Мнение: Вся информация представлена ​​в виде выделенного текста в предложениях, что делает ее более медленной, чем из структурированной таблицы, и намного медленнее, чем из графического представления. Гипотетические и, возможно, косвенные взаимодействия (A регулирует B), несуществующие взаимодействия (A не связывает B) и экспериментальные (A совместно выделяется с B) не дифференцируются.Простота в использовании, чистое разделение видов.

Мнение: Хороший интерфейс, но, как правило, меньше обращений, чем в других базах данных для генов млекопитающих. Вероятно, это связано с тем, что эта база данных содержит в основном взаимодействия дрожжевого белка, где она очень сильная. В настоящее время он распространяется на другие метазои. Хорошее представление доказательств в виде высокой и низкой пропускной способности со ссылкой и описанием.

См. Также

на OpenWetWare

  • Принц из лаборатории OWW работает над белок-белковыми взаимодействиями.
  • Лаборатория Keating
  • OWW также работает над белок-белковыми взаимодействиями.

Списки ресурсов взаимодействия белков:

Поиск по соответствующей литературе

  • search PubMed для термина MeSH Protein Interaction Mapping [5], основная тема [6] и только отзывы [7]

Последние отзывы:

Википедия вступление белка взаимодействия, прогноз взаимодействия

,

CREBBP — CREB-связывающий белок — Homo sapiens (Human)

> sp | Q92793 | CBP_HUMAN CREB-связывающий белок OS = Homo sapiens OX = 9606 GN = CREBBP PE = 1 SV = 3
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGK
SPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLA
ETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHT
NNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNS
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVI
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQA
MGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAG
MAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLS
NQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
 

Отправить ответ

avatar
  Подписаться  
Уведомление о